KEGG   Xenorhabdus nematophila: XNC1_1135Help
Entry
XNC1_1135         CDS       T01274                                 

Gene name
dsbC
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xne  Xenorhabdus nematophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1011343..1012044
Genome map
AA seq 233 aa AA seqDB search
MKKIAFCFSLLLTTFASNAFADESAINNSLSKMGIKAENISPSQLSDISAILTEHGIIYM
SNDGKYLLQGPLYDISGSTPKNISNQVLVKKLDALNNQMIVYKAPKEKHVVTVFTDITCG
YCRKLHENMQEYNDLGITVRYLAFPRHGLQHQSAKDMQSIWCSATPNKSLNAVFKGEKVS
PIKECKTDIAKQYQLGLQFGVQGTPAIVLKDGSVLGGYLPPKDLLATLEKQGE
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcgcgttttgcttttctttactattgaccacttttgccagcaatgctttt
gctgatgaaagcgcaatcaataattcactgtctaagatgggaatcaaagcagaaaatatc
tcaccctcccaactttctgatatcagtgcaattttaactgagcatggcattatttatatg
tccaatgatggtaagtatctgttgcaaggcccactttatgatattagcggaagtacaccg
aaaaatatcagtaatcaggttctggttaaaaaactggacgccctgaacaatcaaatgatc
gtttacaaagcgccgaaagaaaaacatgttgtgacagtttttactgacattacttgtggt
tattgccgtaagctccatgaaaatatgcaggaatataacgatctggggattacggttcgt
tacctggcatttccccgtcatggcttgcaacaccaatctgccaaagatatgcaatccatt
tggtgtagtgcgacaccaaacaaatcactgaatgccgttttcaagggtgaaaaggtttct
cctatcaaagaatgcaaaacggatatcgcaaaacaatatcaattaggcttgcaattcggt
gtccagggtacacctgcgattgtgcttaaagatggtagtgtactcggtggttatttgccg
ccaaaagatttattggcaacgctagaaaaacaaggcgaataa

DBGET integrated database retrieval system