KEGG   Xenorhabdus nematophila: XNC1_1359Help
Entry
XNC1_1359         CDS       T01274                                 

Definition
Chitobiase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xne  Xenorhabdus nematophila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XNC1_1359
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XNC1_1359
Enzymes [BR:xne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XNC1_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1222208..1224907
Genome map
AA seq 899 aa AA seqDB search
MKTAKLRTLAALITIVGFIGSSYAEMSSVEPLQMSPQQVVDSLSQLKVNFKVIDNQAGSH
GTDCAILGADSAACNRVNITLGNGNQAINSADWALYFHSIRQILKLDNVQYKITHITGDL
YKLEPTEKFTGIKANEKIVLPIIGEYWQIYSTDFIPRWYATSGNAEPKILANTDTGNISE
FLSALEGDQWKRTTADHNTLMTAENRFVKNQAMVKIGEDKLRGQIIPTPKVLSIHSQDVD
LSRGVKLELGGLSQESVKLIRERFKSHDINLTDNGYRITTQINENRFKGNWRVKGAYSLE
ITTQGVQVVAFDQSGVFYGLQSLFSLLPANRAPKIATLTVKDAPRFEYRGVFLDVGRNFH
SKEAVLRLLDQMSNYKLNKFHFHLSDDEGWRLEIPGLPELTEIGSQRCHDLSETKCILPQ
LGSGPNSNNMGSGYFSRQDYIDILNYAKARQIEVIPEIDVPAHARAAVVSMEARYKRLMA
EGKVQAANEYRLLDPTDTSNTTSVQFYDRRSYLNPCMDSSKKFIDKVISEIVAMHKAAGL
PLNTWHFGGDEAKNIRLGPGYQDKDEPIVPGKGIINKKIEDKPWAKSQACQKMIAEGVIK
DVDELSSYFAVEVSKIVNAYGIDTMQAWQDGLKHAKSAKDFATKHTAVNFWDTLYWDGYD
LVNNWANKDYRVVISSPDYIYLDMPYEVNPKESGYYWATRFNDEAKIFSFAPNNLPQNAE
TSVDRDGNKFNSHSNKRWSGAYGMSGQLWSEVVRTDEQMEYMIYPRLLPLAERSWHQADW
ELDYQQGREFKGGITHYVDADALNQDWMRFANLIGQNELAKLDKANISYRLPVPGGRIVA
GTFEANIALPGVVIQYSLDGGKTWQIYDDRQRPHVTGNVKIRSVSTDGKRFSRIDDVKF
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgctaaattacgtaccttggcagcactcattacgatagttggatttattgga
agttcttatgcagaaatgtcatctgtggaaccattacagatgtcaccacaacaagtagtg
gattcgctgagtcagttaaaagttaattttaaagtcattgataaccaagccggatcacat
ggcacagactgcgcaatacttggtgctgattcggcggcttgtaatcgggttaatatcact
ttgggcaatggcaatcaggcaatcaattccgctgattgggcactctatttccacagtatt
cgccagatcctgaaacttgataatgttcaatacaaaattacccatatcacgggtgatttg
tataaattggagccgactgagaaatttaccggcatcaaagccaatgaaaagattgtgctg
cctatcattggagagtattggcaaatttacagcacagattttatacctcgctggtatgca
acttccggcaatgcagaacctaagatattggcgaataccgataccggaaacatcagtgaa
tttttatctgctttagagggggatcaatggaaacgtaccacggcagatcataacacgttg
atgacggctgaaaatcgctttgtgaagaatcaggcaatggtaaaaattggcgaggataaa
ctgcgcgggcagattattcccacgcctaaagtactttctattcattcgcaggatgtcgat
ttatcccggggcgtgaaattagaactgggagggttgagccaagaatcggttaaattgatc
agagagcgtttcaaatcccatgatatcaatttaacggataacggctatcgtattacgacc
cagatcaatgaaaacagatttaaaggtaactggcgggtaaaaggggcttattcactagag
atcaccactcagggagtccaagttgtcgcgtttgatcaatcaggtgtcttttatggcttg
caatcactgttttccctgcttcccgccaatcgtgcacctaaaattgctacattgacggta
aaagatgcaccaaggtttgaatatcgcggtgtgttccttgatgttgggcgcaatttccac
agcaaagaagctgtcttgcgtctgctcgatcaaatgtccaattacaagttaaacaaattc
catttccatttgagtgatgatgaaggttggcgtctggaaattcctggtttaccggaactg
acagaaattggcagccaacgttgtcatgatttaagtgaaacgaaatgtatactgccacaa
ttgggatcagggccgaatagcaataatatgggcagtggttattttagccgtcaggattac
attgatatcctgaattacgcaaaagcccgccagatagaagtgatcccagaaattgatgtt
ccggctcatgcccgtgctgcggttgtctcaatggaagcgcgttataagcgattaatggca
gagggcaaagttcaggcagccaatgaatatcgcttgcttgatccgacagatacctcgaac
accacatccgttcagttctacgatcgccggagttaccttaacccgtgcatggattcgtct
aagaagtttattgataaagttatcagcgaaatcgttgccatgcacaaagcagccggattg
ccattgaatacatggcattttggtggtgatgaggcgaaaaatattcgtctggggccggga
tatcaggataaagatgaaccgattgtgccgggaaaagggattatcaacaaaaaaattgaa
gacaaaccctgggctaagtctcaggcctgccagaagatgatcgctgagggtgtgatcaaa
gatgttgatgagctttccagttattttgctgttgaagtcagtaaaatcgtgaatgcttac
ggtattgatacgatgcaggcatggcaggatggtttgaaacacgcaaaatcagccaaagac
tttgcgactaaacatactgcggtcaatttctgggatactctctattgggatggctatgat
ttggtaaataattgggcgaataaggattatcgggttgttatctccagtcctgattatatt
tacctcgatatgccgtatgaagtgaaccccaaagaatctggctattattgggcaacccgg
tttaatgatgaggcgaaaatttttagttttgcgccgaataacttgccacagaatgctgaa
acatccgtcgatcgcgatggcaataaattcaattctcacagcaataaacgttggtcgggg
gcttacgggatgtccgggcaattatggagtgaagttgtgcggacagatgaacagatggaa
tatatgatttatccgcgcttgctgccgttggcggaacggtcatggcatcaggctgactgg
gaactggattatcagcagggcagggaatttaaaggcggcataacgcattatgtcgatgcc
gatgcgcttaatcaggactggatgcgttttgccaatctgatagggcagaatgaactggct
aaattagataaagcgaatatttcataccgtttgccagtaccgggcggaagaattgttgcc
ggaacatttgaagccaatattgccttgccgggtgttgttatccagtattcattggatggt
ggtaaaacatggcagatttatgatgacaggcagcgtcctcatgtcacaggtaatgtgaaa
attcgctctgtcagtaccgatggaaaacgctttagccgaatagacgacgtgaaattttaa

DBGET integrated database retrieval system