KEGG   Xenorhabdus nematophila: XNC1_1410Help
Entry
XNC1_1410         CDS       T01274                                 

Gene name
sucB
Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xne  Xenorhabdus nematophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:xne01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:xne00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:xne00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1290137..1291348
Genome map
AA seq 403 aa AA seqDB search
MSSVEILVPDLPESVADATVATWHKKPGDTVERDEVLVEIETDKVVLEVPASEAGVLEAI
LEEEGATVLSKQLIGRIRLGDSTGIPADVKEKTEATPAQRQTASLEEESNDALSPAVRRL
IAEHDLNPAAIKGSGVGGRIVREDVEKHIAANKKEGDKPAAPASQQSSLSHRSEKRVPMT
RLRKRVAERLLEAKNNTAMLTTFNEVNMKPIQELRKQYGDAFEKRHGMRLGFMSFYVKAV
VEALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDADALSMAEIEKSIKEL
AIKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQV
EILPMMYLALSYDHRLIDGRESVGFLVTIKEMLEDPTRLLLDV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagaaattctggttccggaccttcctgaatctgttgcagatgccactgtt
gcgacatggcataaaaaaccaggtgataccgtagaacgtgacgaagtgctggttgaaatc
gaaactgacaaagttgttttggaagtaccagcaagtgaagcgggtgttctggaagctatt
ttggaagaagagggcgccactgtactgtctaaacaactgatcggtcgtatccgtttgggt
gacagcacaggtattcctgcagacgtgaaagaaaagacagaagcaacgccagcacagcgt
cagactgcttctttggaagaagaaagtaatgatgcactaagcccggccgttcgtcgcttg
atcgcagagcatgacttgaacccggctgcgattaaaggcagtggtgtgggtggtcgtatt
gttcgtgaagacgtagaaaaacacatcgcggcgaataaaaaagaaggtgataaacctgct
gcaccagcttcacagcaatcttccctgtcacatcgcagtgaaaaacgtgttccgatgacc
cgtctgcgcaaacgtgttgcagagcgtctgctggaagcgaaaaacaatacggcaatgttg
acaacattcaatgaagtcaacatgaagccaattcaggaactgcgtaagcaatatggcgat
gcgtttgaaaaacgtcatggcatgcgtttgggcttcatgtctttctatgtgaaggccgtg
gttgaagcactgaaacgttatccagaagttaatgcttctattgatggcaccgatgtggtt
tatcacaactattttgatatcagcattgcagtctctactccacgtggcttggtaacgcca
gtcctgcgtgatgcagatgcactgagcatggctgaaatcgagaaaagtatcaaagagctg
gctatcaaaggccgcgacggtaagttgactgttgaagaactcactggtggtaatttcact
attactaatggcggtgttttcggctccctgatgtccacacctatcattaacccaccacag
agtgcgatcctcggcatgcacgccattaaagatcgtcctatggcagtcaatggtcaggtt
gagatccttcctatgatgtatctggcgctgtcctatgaccaccgtctgattgatggtcgt
gagtctgtaggcttcctggtgaccatcaaagaaatgctggaagatccaacacgtttgttg
ctggatgtatag

DBGET integrated database retrieval system