KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1411Help
Entry
XNC1_1411         CDS       T01274                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00020  Citrate cycle (TCA cycle)
xne00640  Propanoate metabolism
xne00660  C5-Branched dibasic acid metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
Module
xne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XNC1_1411 (sucC)
   00640 Propanoate metabolism
    XNC1_1411 (sucC)
   00660 C5-Branched dibasic acid metabolism
    XNC1_1411 (sucC)
Enzymes [BR:xne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XNC1_1411 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CBJ89474
UniProt: D3VAN8
Position
1291508..1292674
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPAGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAEQWLGKRLVTYQTDAQGQPVHQILVEGATDIAKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAIIDPLTGPMPYQGRELAFKLGLTGKQVGQFTKI
FLGLANLFLERDLTLVEINPLVITTQDDLICLDGKLSADGNAMFRQAELREMHDPSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDENVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAASLTDAAQQAVAAAGNK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacaacttttcgcacggtatggtttaccagcacct
gctggctatgcttgcacaaccccgcgtgaagcagaagaagcagcatccaagattggttct
ggcccttgggtcgttaaatgtcaggttcatgcaggcggccgcggtaaggctggtggcgtg
aaagtcgtcaacagcaaggaagatatccgtgcttttgctgaacaatggctgggtaaacga
ctggtcacttaccagacagatgcacaggggcagcctgttcatcagattttggtggaaggt
gcaaccgatattgccaaggagctgtatctcggtgctgttgttgaccgcggtacacgtcgt
gtagttttcatggcctctactgaaggtggcgtcgaaatagaaaaagtggcggaagaaacg
cccgaactgattcataaagcaatcatcgacccactgactggccctatgccgtatcaaggc
cgtgaattggcgtttaaactcggtttgactggtaagcaagtaggtcaattcaccaagatt
ttcttgggattggcgaacttgttcctggagcgtgatttaactctggttgaaatcaacccg
ctggttattactactcaagatgacctcatctgtctggatggaaaattgagcgctgatggt
aacgcaatgttccgtcaggctgaactgcgtgaaatgcacgatccttcacaggaagaccca
cgtgaagcacaggctgctcagtgggaactgaactatgttgcgctggacggtaacattggt
tgcatggtgaatggtgctggtctggcaatgggaactatggacattgtcaaattgcacggt
ggcgcaccggcaaacttccttgatgtgggtggtggcgcgacaaaagagcgtgttactgaa
gcgttcaaaatcattttgtcagatgaaaatgttaaagctgttttagtcaatatctttggt
ggtatcgtccgttgcgacctgattgctgacggtattattggtgcggtggaagaagtgggt
gttaacgtaccggtagtcgttcgtctggaaggaaacaatgctgaactgggtgctaagaaa
ctggcagacagtggtctgaacatcattgcagctgccagtctgacagatgcagctcaacag
gcagtagcggcagcggggaataaataa

DBGET integrated database retrieval system