KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1425Help
Entry
XNC1_1425         CDS       T01274                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00260  Glycine, serine and threonine metabolism
xne00680  Methane metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xne_M00002  Glycolysis, core module involving three-carbon compounds
xne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_1425 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XNC1_1425 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_1425 (gpmA)
Enzymes [BR:xne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XNC1_1425 (gpmA)
Membrane trafficking [BR:xne04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    XNC1_1425 (gpmA)
Exosome [BR:xne04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XNC1_1425 (gpmA)
  Exosomal proteins of melanoma cells
   XNC1_1425 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBJ89488
UniProt: D3VAQ2
Position
complement(1305730..1306482)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWTDVELSDKGRSEAQQAGQLLKQEGFAFDFAYTSVL
KRAIHTLWNILDQVDQQWLPVEKSWKLNERHYGALQGLDKAETAAKYGDDQVKLWRRGFA
ITPPDLTKDDERYPGHDPRYANLKPEELPVTESLATTIERVIPYWEEIIKPRVEKGEKVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTAVPLVYEFDENMKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaaactggttcttgtaaggcacggagagagcgagtggaacaaagagaac
cgttttactggctggactgatgttgaactgtctgataaaggccgctctgaagcacaacaa
gcgggtcaattgctgaaacaagaaggctttgcttttgatttcgcctatacttccgtttta
aaacgtgccattcacactttgtggaacattctggaccaagtcgaccagcaatggctgcct
gttgaaaaaagctggaaactgaatgaacgccactacggggcgttgcaaggcctggataaa
gcagaaactgccgctaaatacggcgatgaccaagttaaattatggcgtcgtggctttgct
atcactcctcctgatttgaccaaagatgatgagcgttacccggggcatgatcctcgctac
gcaaatcttaaaccagaagaactccctgtaacagaaagcctcgcaactacgattgagcgt
gttattccttattgggaagagattatcaaacctcgcgtagaaaaaggtgagaaagtgatt
attgctgctcacggcaactctctgcgcgcactggtgaaatacctggacaacatgagcgaa
gacgaaattcttgaactgaatattccaactgctgtgccattggtttatgagtttgatgaa
aatatgaaacctatcaaacgctattatctgggcaatgctgatgaaattgcagcgaaagca
gcggcggtagcaaaccaaggtaaggcgaagtaa

DBGET integrated database retrieval system