KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1425Help
Entry
XNC1_1425         CDS       T01274                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_1425 (gpmA)
   01230 Biosynthesis of amino acids
    XNC1_1425 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_1425 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XNC1_1425 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_1425 (gpmA)
Enzymes [BR:xne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XNC1_1425 (gpmA)
Exosome [BR:xne04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XNC1_1425 (gpmA)
  Exosomal proteins of melanoma cells
   XNC1_1425 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1305730..1306482)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWTDVELSDKGRSEAQQAGQLLKQEGFAFDFAYTSVL
KRAIHTLWNILDQVDQQWLPVEKSWKLNERHYGALQGLDKAETAAKYGDDQVKLWRRGFA
ITPPDLTKDDERYPGHDPRYANLKPEELPVTESLATTIERVIPYWEEIIKPRVEKGEKVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTAVPLVYEFDENMKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaaactggttcttgtaaggcacggagagagcgagtggaacaaagagaac
cgttttactggctggactgatgttgaactgtctgataaaggccgctctgaagcacaacaa
gcgggtcaattgctgaaacaagaaggctttgcttttgatttcgcctatacttccgtttta
aaacgtgccattcacactttgtggaacattctggaccaagtcgaccagcaatggctgcct
gttgaaaaaagctggaaactgaatgaacgccactacggggcgttgcaaggcctggataaa
gcagaaactgccgctaaatacggcgatgaccaagttaaattatggcgtcgtggctttgct
atcactcctcctgatttgaccaaagatgatgagcgttacccggggcatgatcctcgctac
gcaaatcttaaaccagaagaactccctgtaacagaaagcctcgcaactacgattgagcgt
gttattccttattgggaagagattatcaaacctcgcgtagaaaaaggtgagaaagtgatt
attgctgctcacggcaactctctgcgcgcactggtgaaatacctggacaacatgagcgaa
gacgaaattcttgaactgaatattccaactgctgtgccattggtttatgagtttgatgaa
aatatgaaacctatcaaacgctattatctgggcaatgctgatgaaattgcagcgaaagca
gcggcggtagcaaaccaaggtaaggcgaagtaa

DBGET integrated database retrieval system