KEGG   Xenorhabdus nematophila: XNC1_1519Help
Entry
XNC1_1519         CDS       T01274                                 

Gene name
hisD
Definition
bifunctional HisD L-histidinal:NAD+ dehydrogenase/L-histidinol:NAD+ dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
xne  Xenorhabdus nematophila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xne01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:xne00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1402513..1403838)
Genome map
AA seq 441 aa AA seqDB search
MKTHFETIVRWQACTPQQQKVLLTRPAVTASEDISYTVKHILETVKTRGDQSLQEFSQRF
DKTTIETLQISANEMDTAARRLTPEIKQAIQQAMNNIRRFHEAQKPVEIDVETVPGVRCQ
QITRPIDSVGLYIPGGSAPLPSTVLMLGIPANIAGCRKIILCSPPPIADEILYAAQLCGI
SEIFQIGGAQAIAAMAFGTESVPKVDKIFGPGNAWVTEAKRQISQCIDGAAIDMPAGPSE
VLVIADHGANPAFTAADLLSQAEHGPDSQVMLVTPDESFARKVIGEIATQLKALPRQQIA
IQALQTSQVIIAEDLDQCVAISNQYGPEHLIIQTRQPEQWVEQITNAGSIFLGDWSPESA
GDYASGTNHVLPTYGYTSTYSSLGLTDFLKRMTVQQLTPQGLRNLASTIEILAQAEQLIA
HKNAVTLRMAALNNSNVGSQS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcatttcgagaccatcgttcgctggcaagcatgcacaccgcaacaacaaaag
gttttgctgacacgtccagccgtcaccgcatccgaggacatttcctatacagttaaacac
attttagaaacagtaaaaacacgcggcgatcagtcattacaagaattcagtcaacgcttc
gataaaacgactattgagactctccagatttcagccaatgaaatggataccgcggctcgc
cgcctcaccccggagattaaacaagctatacagcaggctatgaacaatattcgtcgattc
cacgaagcacaaaaaccggtagaaattgatgttgaaacagtaccgggtgttcgctgccag
caaatcacgcgcccaatagattcggttggactctatattccgggcggctcagcacccttg
ccttccacagtacttatgctgggtataccagccaatattgcgggatgccgtaaaattatc
ctctgttctcctcctcccattgctgatgaaatcctctatgcagcacaattgtgcggaatc
agtgaaattttccagattggcggtgcacaagccattgcagcaatggcatttgggacagaa
tccgttcctaaagtggataaaatttttggcccgggcaacgcatgggtcacagaagccaaa
cgccagatcagccaatgtattgatggtgcagcgatcgacatgcccgcaggcccatccgaa
gtattggttatcgctgatcacggagccaatccggcctttacagcagcagacctgctttct
caagcagaacacggtcctgattctcaggtcatgctggtaacgcctgacgaatcctttgcc
aggaaagtgattggtgaaattgcaactcagcttaaagcattgcctcgccagcagattgca
attcaggcgttacaaaccagtcaggttattattgctgaagatctcgaccaatgcgtagcg
atcagtaaccaatacgggcctgaacatttaatcattcaaacccgccaaccagaacaatgg
gtagaacagatcaccaatgccggatctattttcctcggtgattggtcacctgaatccgca
ggcgattacgcttccggcactaatcacgttctacctacctatggctatacttcaacctat
tccagtctggggctgactgattttctaaaacgaatgactgttcaacaactcacaccacaa
ggattgagaaatctcgcatcaactatcgaaatattggcacaggcagaacagctcatcgca
cacaagaacgccgtgacattacgtatggctgctctcaataactcaaatgtgggctcacaa
agctag

DBGET integrated database retrieval system