KEGG   Xenorhabdus nematophila: XNC1_1618Help
Entry
XNC1_1618         CDS       T01274                                 

Gene name
cheR
Definition
glutamate methyltransferase, chemotactic response regulator (EC:2.1.1.80)
Orthology
K00575  
chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
xne  Xenorhabdus nematophila
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:xne00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XNC1_1618 (cheR)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XNC1_1618 (cheR)
Enzymes [BR:xne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     XNC1_1618 (cheR)
Bacterial motility proteins [BR:xne02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XNC1_1618 (cheR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1508771..1509658)
Genome map
AA seq 295 aa AA seqDB search
MKSNLTASETDAISPLNFMLQRHALTDAQFERICQFIYQRAGIVLAKNKREMVYNRLVRR
LRILELNNFGQYLSILEQNTHSSEWELFINALTTNLTAFFREVHHFPILAAHASRKNGGT
YRVWSAAASTGEEPYSIAMTLCDALGHRSNRIKIIGSDIDTSVLEKARQGVYRLEELQSL
SESQKKKYFFKGVGLFEGYARVRPLLAELVSFQHLNLLDSDWGLDGKFDAIFCRNVMIYF
DKKTQERILRRFVNFLKPDGLLFAGHSENVTQISREFYLQGQTVYGVGRARRGHE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaatttaacagcttcagagactgatgctatttcgccgctgaactttatgctt
cagcggcatgctttgacggatgcccaatttgagcgcatctgtcagtttatctatcaacga
gcaggtattgtactggcaaaaaataaacgtgagatggtatacaaccgcttagtcaggcgg
cttcgtatattggaactcaataactttggtcaatatctgtcgattctggaacaaaatact
cacagcagtgaatgggaattgtttatcaacgcattgacgacgaatctcacggcatttttc
agggaagttcaccattttcctattttggcagcacatgccagcaggaaaaatggaggaaca
taccgcgtttggagcgccgccgcttcaacgggggaggagccgtattctattgcaatgacc
ttgtgtgatgcgctggggcatcgttcaaatcggataaaaatcattggcagtgatatcgat
accagtgtgctggagaaagcccggcagggtgtttatcgactggaagaattacagtctctg
agtgagagccaaaagaaaaaatattttttcaaaggcgttggccttttcgagggatatgct
cgggttcgccctctgcttgcagaattagtcagttttcagcacttgaatctattggattct
gattgggggcttgacggtaaatttgatgcgatattctgtcgtaatgtcatgatttatttt
gataaaaagacacaggaaaggatcttgcgccgttttgtcaatttcttaaaaccggatggt
ttgcttttcgcagggcattccgaaaacgtcactcaaatcagccgagagttctacttgcaa
ggacagaccgtttacggtgtaggtcgggcaaggaggggtcatgaataa

DBGET integrated database retrieval system