KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2150Help
Entry
XNC1_2150         CDS       T01274                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction helicase, subunit A
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XNC1_2150 (ruvA)
Enzymes [BR:xne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XNC1_2150 (ruvA)
DNA repair and recombination proteins [BR:xne03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XNC1_2150 (ruvA)
    RecFOR pathway proteins
     XNC1_2150 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_2 HHH_8 HHH_3 FeS_assembly_P Transposase_20 LcrG
Motif
Other DBs
NCBI-ProteinID: CBJ90209
UniProt: D3VEU7
Position
2059931..2060548
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGTVLEKQPPLVLLETNGVGYEVHMPMTCFYELPEIGQQAILFTQFVVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVTAIEQEAIASLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNQSSDINLPAAAKQTNSDADIEAEAAAALVSLGYKPQEAS
RMVSKVVKPGADCETLIREALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgtttgagaggaaccgtgttggaaaaacagccaccattggtgttactggaa
acgaatggtgtcggttatgaagttcatatgccaatgacctgtttttatgaactgcctgaa
attggtcaacaagctattttatttacgcaatttgttgtgcgcgaagatgcccaattatta
tacggatttaatgataaacaagagcgtgcccttttccgtgaactgatcaaagtgaatggt
gttgggccaaagttggctctggcaatcctttctggcatgtccgcccagcaatttgtcact
gccattgaacaggaagcgattgcttcactggtcaaattacctggagtgggtaaaaaaact
gctgaaaggttggtggtcgaaatgaaagatcgctttaaagggcttaatggcgatctgttt
aatcaaagtagtgacatcaatttacctgccgccgccaaacagacgaattctgatgccgat
attgaagcagaagctgcggcagcactggtttctctggggtataaaccgcaggaagccagc
cgaatggtgagtaaagtagttaaaccgggtgcagattgtgaaacgctgatccgcgaagcg
cttcgtgcggctttgtaa

DBGET integrated database retrieval system