KEGG   Xenorhabdus nematophila: XNC1_2340Help
Entry
XNC1_2340         CDS       T01274                                 

Definition
Gifsy-2 prophage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xne  Xenorhabdus nematophila
Brite
Enzymes [BR:xne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     XNC1_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2288890..2289330
Genome map
AA seq 146 aa AA seqDB search
MQISEQGLLLLKQSEGCRTQAYQDCVGVWTIGYGWTQSVEGIPIYAGMTISTTQAEQLLQ
QGLHRYEAAVLHLVKVSLTQGQFDALINFTYNVGESALAHSTLLKYLNAGNYAAAADEFL
RWNWAKGQQLPGLTRRRQAEKELFLS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcagataagtgaacaggggctgttattgctcaaacaatctgaaggttgtcgtactcag
gcctaccaggattgtgtgggagtctggacgattggttacggctggacgcagtcggtagag
ggaataccaatatatgctggcatgacgatcagcacgactcaagcagagcaactcttgcaa
caagggctgcatcgctacgaagctgccgtcttacatctggtaaaggtatcgctaacacaa
ggtcagttcgatgcgttgattaatttcacctataacgtgggggagtcggcgctggcacat
tccactttactcaaatatcttaacgctggaaattatgctgccgccgctgatgaattcctc
cgttggaactgggcaaaagggcaacaattgcctggactgactcgccgtaggcaggcagaa
aaggagctgtttctatcatga

DBGET integrated database retrieval system