KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2436Help
Entry
XNC1_2436         CDS       T01274                                 

Gene name
trpC
Definition
(GenBank) bifunctional: indole-3-glycerolphosphate synthetase (N-terminal); N-(5-phosphoribosyl)anthranilate isomerase (C-terminal)
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01130  Biosynthesis of antibiotics
xne01230  Biosynthesis of amino acids
Module
xne_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XNC1_2436 (trpC)
Enzymes [BR:xne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XNC1_2436 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     XNC1_2436 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CBJ90495
UniProt: D3VGQ9
Position
2365464..2366828
Genome map
AA seq 454 aa AA seqDB search
MKTSVLQKIIDDKAVYLATRKAEQPLESFIDSVVPSHRRFYQALTHKQTVFILECKKASP
SKGLIREDFDPVRIAKTYQPYAAAISVLTDEKYFQGSYDFLKIVSNAVHQPVLCKDFIID
PYQIYLARYYQADAILLMLSVLDDETYREFSALAHTLNMGVLTEVSNEEEQQRAIALGAK
VIGINNRDLRDLSIDLERTRKLAVGLPEGTIIISESGIHQHRQVRELSQFAHGFLIGSAL
MAQHNLDLALRRLIFGDNKICGLTRPQDAKMALQAGAVYGGLIFAEKSPRKINLQKAQQI
INEASLQYVGVFQNQSINFISHLARTLSLSAVQLHGQEDAHYINALRSVLPEYCEIWKAI
DMSKSADFSEITHVDHLLLDNGSGGTGSPFNWGLIDPRLQHNSILAGGLNRENCQQAATF
GCYGLDFNSGVEISPGIKSSQKIRQVFQQLRCYH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccagtgtattacagaaaatcattgatgataaggcagtatatttagccacccgt
aaagcggaacaaccgctggaaagttttattgattctgttgtgccgagtcaccgtcggttc
tatcaggcattgacccataagcaaacggtttttattttagagtgcaaaaaagcctctccg
tctaaagggttaattcgtgaagatttcgatcctgtccgcattgccaaaacttaccagccc
tatgctgctgctatttcagtcctgactgatgaaaaatattttcagggcagttatgatttt
ctcaaaatagtcagcaatgctgttcatcagcctgttttatgtaaagattttattattgat
ccttatcagatttatctcgcgcgctattatcaggccgatgcaattttactcatgctctcg
gtgcttgatgatgaaacatatcgtgaattttccgctctggcacacacgcttaatatgggc
gtactgaccgaagtcagtaatgaagaagagcagcaacgggccattgcattgggcgcaaaa
gtcattggtatcaataaccgcgatctgcgtgacctgtcgattgatttagagcgtacacgt
aaactggctgtgggtttacctgaaggcacgattattatcagtgaatccggtatccaccag
catcgtcaggtgcgggaattaagtcagtttgctcacggttttctcatcggcagtgctttg
atggcacaacataatttagatcttgcattacgtcgtttaatttttggtgataataaaatt
tgcggattgacccggccacaagatgcaaaaatggctttacaggcgggcgctgtctatggt
gggttaatttttgccgaaaaatcaccgcgtaaaattaacctgcaaaaagcgcagcagatt
atcaatgaagcctctctacaatatgtgggtgtatttcagaatcaatcgattaattttatc
agtcatcttgcccggacactttcattaagtgcggttcaactacatggtcaggaagatgcg
cattacatcaacgccttacgatctgtattacctgaatattgtgagatttggaaagccatc
gacatgtcaaaatcggcggatttttccgaaataactcatgtcgatcatttattgctggat
aatgggtcagggggaacaggctcgccatttaattggggactgattgatccccgtttgcaa
cataatagtattttagcgggtgggctgaacagggagaattgccagcaagcagcaactttt
ggctgttacggactggattttaattcaggtgtcgaaatttctcccggaattaaaagcagt
caaaaaatcagacaagtattccaacaattacgctgttatcactaa

DBGET integrated database retrieval system