KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2437Help
Entry
XNC1_2437         CDS       T01274                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase, beta protein (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XNC1_2437 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_2437 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XNC1_2437 (trpB)
Enzymes [BR:xne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XNC1_2437 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2366908..2368098
Genome map
AA seq 396 aa AA seqDB search
MSKLNPYFGDFGGQFVPQILIPALNQLEDAFIDAQKDPEFQREFQALLKNYAGRPTALTR
CQNLTKGTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEAMRDWSGSY
DKAHYLLGTAAGPHPYPTIVREFQRMIGEEAKAQILEKEGRLPDAVIACIGGGSNAIGLF
AEFIPENNVRLIGVEPAGHGIETGEHGAPLKHGKLGIYFGMKAPIMQTEDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDNEALDAFQALSRNEGIIPALESSHALAYALKM
IHQAPDKEQLLIVNLSGRGDKDIFTVHDILKSRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaaatccttattttggcgattttggcggacaatttgttcctcaaatcttg
atccctgcccttaaccaattagaagatgcctttattgatgctcaaaaagatcctgaattt
cagcgcgaatttcaggcattattgaaaaactatgcagggcgtcctaccgccttaacacgg
tgccagaacctgactaaaggcacaaaaacacgcctatacctgaaacgcgaagatttactt
cacggaggtgctcacaaaactaatcaagtcctggggcaagccttgctcgcaaagcgaatg
gggaagcatgagattattgccgaaacaggtgcggggcagcatggtgtagcaaccgctctg
gcttgtgctttgttagggctaaaatgccggatttacatgggagccaaagatattgaacgc
caatctcccaatgttttccgtatgcgtttgatgggagccgaagtgatccctgttcacagc
ggttctgcaaccttgaaagatgcctgtaatgaagcaatgcgtgactggtcaggttcttat
gataaagcccactatttattgggaaccgcagccggccctcacccatatccgacaatagtc
agagaatttcagcgcatgattggtgaagaagccaaagcgcaaattctggaaaaagaagga
cgactgcccgatgcagtgattgcctgtattggcggtggttcaaatgccattggcctgttt
gctgaatttatcccagaaaataatgttcgcttaatcggtgtcgaacctgccggacacggt
atcgaaacaggcgagcacggggcaccattgaagcatggtaaattagggatttacttcggt
atgaaagcgccgattatgcaaacagaagatggacaaattgaagaatcttattccatttcg
gctggtttagattttccttccgttggccctcaacatgcttatctaaatagcattggcaga
gctgattatgtctcaataactgataatgaagcgcttgatgctttccaggcattatcacgc
aatgaaggcattattcccgcattagaatcgtcccatgcactggcctatgctttgaaaatg
atccatcaggccccggataaagaacaattattgattgtcaatttatccggccgtggcgac
aaagacatctttaccgttcacgatatcttaaaatccaggggggaaatctga

DBGET integrated database retrieval system