KEGG   Xenorhabdus nematophila: XNC1_2437Help
Entry
XNC1_2437         CDS       T01274                                 

Gene name
trpB
Definition
tryptophan synthase, beta protein (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xne  Xenorhabdus nematophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XNC1_2437 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_2437 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XNC1_2437 (trpB)
Enzymes [BR:xne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XNC1_2437 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2366908..2368098
Genome map
AA seq 396 aa AA seqDB search
MSKLNPYFGDFGGQFVPQILIPALNQLEDAFIDAQKDPEFQREFQALLKNYAGRPTALTR
CQNLTKGTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEAMRDWSGSY
DKAHYLLGTAAGPHPYPTIVREFQRMIGEEAKAQILEKEGRLPDAVIACIGGGSNAIGLF
AEFIPENNVRLIGVEPAGHGIETGEHGAPLKHGKLGIYFGMKAPIMQTEDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDNEALDAFQALSRNEGIIPALESSHALAYALKM
IHQAPDKEQLLIVNLSGRGDKDIFTVHDILKSRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaaatccttattttggcgattttggcggacaatttgttcctcaaatcttg
atccctgcccttaaccaattagaagatgcctttattgatgctcaaaaagatcctgaattt
cagcgcgaatttcaggcattattgaaaaactatgcagggcgtcctaccgccttaacacgg
tgccagaacctgactaaaggcacaaaaacacgcctatacctgaaacgcgaagatttactt
cacggaggtgctcacaaaactaatcaagtcctggggcaagccttgctcgcaaagcgaatg
gggaagcatgagattattgccgaaacaggtgcggggcagcatggtgtagcaaccgctctg
gcttgtgctttgttagggctaaaatgccggatttacatgggagccaaagatattgaacgc
caatctcccaatgttttccgtatgcgtttgatgggagccgaagtgatccctgttcacagc
ggttctgcaaccttgaaagatgcctgtaatgaagcaatgcgtgactggtcaggttcttat
gataaagcccactatttattgggaaccgcagccggccctcacccatatccgacaatagtc
agagaatttcagcgcatgattggtgaagaagccaaagcgcaaattctggaaaaagaagga
cgactgcccgatgcagtgattgcctgtattggcggtggttcaaatgccattggcctgttt
gctgaatttatcccagaaaataatgttcgcttaatcggtgtcgaacctgccggacacggt
atcgaaacaggcgagcacggggcaccattgaagcatggtaaattagggatttacttcggt
atgaaagcgccgattatgcaaacagaagatggacaaattgaagaatcttattccatttcg
gctggtttagattttccttccgttggccctcaacatgcttatctaaatagcattggcaga
gctgattatgtctcaataactgataatgaagcgcttgatgctttccaggcattatcacgc
aatgaaggcattattcccgcattagaatcgtcccatgcactggcctatgctttgaaaatg
atccatcaggccccggataaagaacaattattgattgtcaatttatccggccgtggcgac
aaagacatctttaccgttcacgatatcttaaaatccaggggggaaatctga

DBGET integrated database retrieval system