KEGG   Xenorhabdus nematophila: XNC1_2488Help
Entry
XNC1_2488         CDS       T01274                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xne  Xenorhabdus nematophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XNC1_2488 (galU)
   00052 Galactose metabolism
    XNC1_2488 (galU)
   00500 Starch and sucrose metabolism
    XNC1_2488 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XNC1_2488 (galU)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XNC1_2488 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2441171..2442088)
Genome map
AA seq 305 aa AA seqDB search
MSAVTKKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIKAGINEIILV
THSSKNSIENHFDTSFELEAILEQRVKRQLLDEVQSICPSHVTIMQTRQGIAKGLGHAVL
CAKPLIGDEPFAVILPDVILDEYSADLSKYNLSEMLSRFNGSGKSQILVEPVPEESVSSY
GIVDCLGEELQPGDSKPIVRVVEKPKPEEAPSNLSIVGRYVLSEKIWPLLAKTAPGAGDE
IQLTDAIAMLMEKEAVEAYHLQGRSHDCGNKLGYMQAFVEYGMRHQELGKSFTNWIMALQ
NQIEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagtaactaaaaaagtaagaaaggctgttatccccgtagcgggtttaggaacc
aggatgttacccgccactaaagctatcccgaaagaaatgcttcctttagtagataaaccg
cttattcagtatgttgtcaatgaatgtatcaaagcaggcattaatgaaattatcctggtt
acacactcatcgaagaactctatagaaaaccattttgataccagttttgaattggaagcc
attcttgagcaaagggtcaaacgccagttattagatgaagtacagtctatctgcccaagt
catgtgacgataatgcaaaccagacagggtattgcaaaaggtttagggcatgcggtgtta
tgcgctaaaccgcttattggagatgagccgtttgcggtgattttgccggatgttattttg
gatgagtatagtgctgatttatcaaaatataatctgagtgaaatgctctcgcgttttaat
ggcagtgggaaaagtcagattctggtagagcctgtacctgaagaaagtgtttcaagctat
ggcattgtggattgcttaggtgaagaattacaacctggcgacagtaaacccattgttcgt
gttgttgaaaaaccgaaaccagaagaagcaccatccaatctttctatagtcggtcgttat
gtattatccgaaaaaatttggccattattggcaaaaacggcaccaggtgctggtgatgaa
atacaattaacagatgctattgctatgttaatggaaaaagaggctgtcgaggcttatcac
ctacagggccgtagccatgattgcggtaataaattgggttatatgcaggcatttgttgaa
tatggcatgagacaccaggaattgggtaaatcattcacgaattggatcatggccttgcaa
aatcagattgagaaataa

DBGET integrated database retrieval system