KEGG   Xenorhabdus nematophila: XNC1_2501Help
Entry
XNC1_2501         CDS       T01274                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
xne  Xenorhabdus nematophila
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    XNC1_2501 (pncA)
Enzymes [BR:xne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     XNC1_2501 (pncA)
    3.5.1.-  
     XNC1_2501 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2453840..2454508
Genome map
AA seq 222 aa AA seqDB search
MKTALLLIDLQNDFCTGGALAVKESDSVIDIANEVIALCQKNTGQENKIPIIASQDWHPA
DHMSFAANSGQKVGESGELNGIPQVWWPVHCVQGQFGAEFHSALNQSAIQEIFRKGENSQ
IDSYSAFFDNDHKSETRLHRWLKEQNIQRLFVLGIATDYCVKFTVLDALMLGYETYVITD
GCRGVNLDADDSKLAFEEMAAKGAQLISLNELTCTHLPENWQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcattattacttatcgatctgcaaaatgatttctgcaccggaggtgcattg
gcagtcaaggagagtgattctgtcattgacatagcaaatgaagttattgcgctatgccag
aaaaatactggccaggaaaacaaaatccctatcatcgcaagtcaggattggcatcccgct
gaccatatgagctttgctgccaattccgggcagaaagtcggtgagtcaggcgaactaaac
ggtattccccaagtatggtggcctgttcattgtgttcaggggcaatttggcgcagaattc
cattccgcattaaatcaatcagcgattcaagaaatattccggaaaggtgaaaattctcag
atagatagctacagtgctttctttgataatgatcataaaagcgaaacccgcttacatcga
tggttaaaggaacaaaatatacaacgcctgtttgtattagggatcgccacggattactgt
gtaaaatttacggtgcttgatgctttaatgctgggatatgaaacctatgtgattactgac
ggttgccgtggcgttaatcttgatgccgatgacagtaagctcgcatttgaagaaatggca
gccaaaggcgctcaattaatctcattgaatgaattaacttgtactcacttaccggagaac
tggcaatag

DBGET integrated database retrieval system