KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2670Help
Entry
XNC1_2670         CDS       T01274                                 

Gene name
hda
Definition
(GenBank) regulatory factor involved in inactivation of DnaA
  KO
K10763  
DnaA-homolog protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
DNA replication proteins [BR:xne03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    XNC1_2670 (hda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2626773..2627438)
Genome map
AA seq 221 aa AA seqDB search
MPDDETFASFFAGENTSLLAAIKLAISQSHGSYIYFWSRDGGGKSHLLHAACTELSQQEE
AVGYVPLDKRAYFVPEVLDGMEHLSLVCIDNIECIAGDQEWEMAIFNLYNRIVEIGRTCL
LITGDRPPRQINLTLPDLASRLDWGQIYKLQPLSDDEKILALQLRAKLRGFELPEDVGRF
VLKRLDREMQTLFKTLDELDRASIVAQRKLTIPFVKDILEL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgatgatgaaacttttgccagtttctttgcaggtgagaatacttccttattagct
gcaataaaattggcgattagtcagtcacacggaagttatatctatttttggtcccgtgat
ggcgggggcaagagccatctgcttcatgcagcctgtactgagttgtcccaacaagaagaa
gctgtgggatatgtaccgctggataaacgtgcctattttgttcctgaagttcttgatggc
atggaacacttatctctggtgtgtatcgataacattgagtgtattgcgggtgatcaagaa
tgggaaatggctatttttaatctgtataatcggattgttgaaattggtcgaacttgcctt
ctgatcacaggtgatcgccctccacggcaaattaacctgacgttaccggatctggcatct
cgtctggactgggggcaaatttataaattacagcctttgtctgacgatgaaaaaattctg
gcattacagttgcgggccaagttacggggttttgaattacctgaagatgtcgggcgtttc
gtgttgaaacggcttgatcgggaaatgcaaacgctgtttaagactttggatgaactggat
cgtgcctctattgtcgcgcaacgtaaactgaccatcccgtttgtgaaagatattcttgag
ctctga

DBGET integrated database retrieval system