KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3194Help
Entry
XNC1_3194         CDS       T01274                                 

Gene name
fadJ
Definition
(GenBank) bifunctional anaerobic fatty acid oxidation complex protein: enoyl-CoA hydratase/epimerase/isomerase (N-terminal); 3-hydroxyacyl-CoA dehydrogenase (C-terminal)
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00071  Fatty acid degradation
xne00280  Valine, leucine and isoleucine degradation
xne00281  Geraniol degradation
xne00310  Lysine degradation
xne00362  Benzoate degradation
xne00380  Tryptophan metabolism
xne00410  beta-Alanine metabolism
xne00640  Propanoate metabolism
xne00650  Butanoate metabolism
xne00903  Limonene and pinene degradation
xne00930  Caprolactam degradation
xne01040  Biosynthesis of unsaturated fatty acids
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
xne01212  Fatty acid metabolism
Module
xne_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XNC1_3194 (fadJ)
   00650 Butanoate metabolism
    XNC1_3194 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    XNC1_3194 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    XNC1_3194 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XNC1_3194 (fadJ)
   00310 Lysine degradation
    XNC1_3194 (fadJ)
   00380 Tryptophan metabolism
    XNC1_3194 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XNC1_3194 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XNC1_3194 (fadJ)
   00281 Geraniol degradation
    XNC1_3194 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XNC1_3194 (fadJ)
   00930 Caprolactam degradation
    XNC1_3194 (fadJ)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XNC1_3194 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XNC1_3194 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XNC1_3194 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CBJ91246
UniProt: D3VKY8
Position
complement(3138968..3141145)
Genome map
AA seq 725 aa AA seqDB search
MAQAEKEVVILTKQSDRSVFNFAVREDKVGVITIDVPGEKVNTLKAEFVEQFLTMFEKAQ
QVSGLKGLVIISGKPDTFIAGADISMIAGCQTQEEATELAEKGQKLFAQIANYPLPIVAA
VHGACLGGGLELALACHARICSLDERTRLGLPEVQLGLLPGSGGTQRLPRLIGVSAALDM
ILTGRQLKAKQAQRLGVVDDAVPLEILLDVAVQYAKKGIIKRKPLAWSQRIMASALGRPL
LFHMVHQKTQAKTHGHYPAPEKIINVIRTGLEKGAIHGFKTEAKAFGELAMSKESEALRS
LFFASTTLKNETGSSEQPAEIKQVGILGGGLMGGGIANVTMSRGNLPVRIKDINEKGINQ
ALKYTWDLLSKRVKQRRLKPSERSRQMSLLTGTTDYSGFKQADIVVEAVFEDLILKRKMV
SEVEDNTKPDTIFASNTSSLPIHKIAEVSTRPEQVIGLHYFSPVDKMPLVEVIPHAGTSE
KTIATAVALAKKQGKTAIVVGDKAGFYVNRILTPYINEAGYCLVAGEPIDHIDKALVNFG
FPIGPINLLDEVGIDVGTKIIPILVEQLGNRFTAPDILAAILKDNRKGKKNRRGFYSYVS
KKGLLKFFSKGIKEVDESIYSLLKIKPAAKMSPADIAQRCVMLMLNEAVRCLDENIIRSP
RDGDIGAVFGIGFPPFLGGPFRYIDHLGSDKVVGILRHLESQYGERFTPCEGLIRMAEQK
KKFYS
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggctgaaaaagaagttgtcatcttaacaaagcaatcagatcgatccgtattc
aatttcgctgtcagagaggacaaagtaggcgtcattactattgatgtacccggcgagaaa
gtgaataccctgaaagccgagtttgttgaacagttcctgacgatgtttgagaaagcgcaa
caagtttccggtttaaaagggctggtgattatatccggaaagccggatacgtttattgct
ggtgcagatatcagtatgattgctggctgccaaacacaggaagaagcaacagaattagct
gaaaaaggtcaaaaactctttgcacagattgctaattatcctttaccgattgtggcagcg
gttcatggagcgtgtttaggtggtgggctagaattagcattagcttgccacgcacgaatc
tgttctttggatgaaagaacccgtcttggtttgccagaagttcagcttgggttattaccc
ggctcagggggaactcagcggctgcctcggttgattggtgtcagtgctgctttggacatg
atattgactggccgtcagcttaaggcaaaacaggcccagcggctgggtgttgtggatgat
gccgttcctttggagatcttgctggatgttgctgtgcaatatgctaaaaaaggcattatc
aaacgcaaaccattagcttggtcacaacgtataatggcgagtgcactgggcaggccacta
ctatttcatatggtgcatcaaaaaacacaagccaaaactcacggtcattatccggcacca
gaaaaaatcatcaatgtgatccgcacagggctggaaaaaggcgcgatacacggttttaag
actgaagccaaggcattcggcgagttggctatgtcaaaggagtcagaagcgttgcgaagt
ttgtttttcgcttcgacgacgttaaaaaatgaaactggctcgtcggaacaacctgctgaa
atcaagcaggtaggcattctgggtgggggattgatgggcggtggtattgctaatgttact
atgtccagaggcaatctacctgtccgcattaaagacattaacgaaaaaggtatcaatcag
gcactgaaatatacatgggatctgctgtctaagcgggtaaaacagcgccgtttaaaaccc
agtgagcgttcccgacaaatgtctctgttgaccggcactacagattacagcgggtttaag
caagcagatattgtcgttgaagctgtatttgaagatttgatactgaagcgcaaaatggtt
tcggaagttgaagacaacacaaaacctgacactatttttgcttctaatacttcttcttta
cccatccataaaattgctgaagtttcaactcggcctgagcaggtcattggtctccactat
tttagccctgttgacaaaatgcctctggtggaagttattccacacgcagggacaagtgaa
aaaacgattgctactgctgttgcgttggctaagaaacagggaaaaacagccattgtggta
ggagataaagccgggttctacgtgaaccgaattttgacaccttacattaatgaagcgggt
tactgcctggtcgcgggagaacccattgatcacattgacaaagcgcttgtgaatttcggt
ttccctattggtccaatcaatttgttggacgaagttggtatagatgtgggtactaaaatt
attccgatattagtagagcagttagggaatcggtttactgctccggatattttggcagcg
atcttaaaagataataggaaaggcaagaagaatagaaggggtttttattcctatgtgagt
aaaaagggcttgctcaaattttttagtaaaggaatcaaagaagtagacgaatctatttat
tccttattaaaaattaagcctgcggcaaaaatgtcaccggctgatattgcccaacgttgc
gtgatgcttatgctgaacgaagcggttcgctgtttggatgaaaatattatccgaagtcct
cgtgatggtgatattggggctgtatttggtattggatttccgccattcctgggtgggcca
ttccgttatattgatcatctgggtagtgataaggtcgtgggaattttacgccatttagag
tcacaatatggagagagatttactccgtgtgaggggttaatccggatggctgaacagaaa
aagaaattttactcataa

DBGET integrated database retrieval system