KEGG   Xenorhabdus nematophila: XNC1_3194Help
Entry
XNC1_3194         CDS       T01274                                 

Gene name
fadJ
Definition
bifunctional anaerobic fatty acid oxidation complex protein enoyl-CoA hydratase/epimerase/isomerase/3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 4.2.1.17 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xne  Xenorhabdus nematophila
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_3194 (fadJ)
   01212 Fatty acid metabolism
    XNC1_3194 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XNC1_3194 (fadJ)
   00650 Butanoate metabolism
    XNC1_3194 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    XNC1_3194 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    XNC1_3194 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XNC1_3194 (fadJ)
   00310 Lysine degradation
    XNC1_3194 (fadJ)
   00380 Tryptophan metabolism
    XNC1_3194 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XNC1_3194 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XNC1_3194 (fadJ)
   00281 Geraniol degradation
    XNC1_3194 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XNC1_3194 (fadJ)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XNC1_3194 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XNC1_3194 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XNC1_3194 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3138968..3141145)
Genome map
AA seq 725 aa AA seqDB search
MAQAEKEVVILTKQSDRSVFNFAVREDKVGVITIDVPGEKVNTLKAEFVEQFLTMFEKAQ
QVSGLKGLVIISGKPDTFIAGADISMIAGCQTQEEATELAEKGQKLFAQIANYPLPIVAA
VHGACLGGGLELALACHARICSLDERTRLGLPEVQLGLLPGSGGTQRLPRLIGVSAALDM
ILTGRQLKAKQAQRLGVVDDAVPLEILLDVAVQYAKKGIIKRKPLAWSQRIMASALGRPL
LFHMVHQKTQAKTHGHYPAPEKIINVIRTGLEKGAIHGFKTEAKAFGELAMSKESEALRS
LFFASTTLKNETGSSEQPAEIKQVGILGGGLMGGGIANVTMSRGNLPVRIKDINEKGINQ
ALKYTWDLLSKRVKQRRLKPSERSRQMSLLTGTTDYSGFKQADIVVEAVFEDLILKRKMV
SEVEDNTKPDTIFASNTSSLPIHKIAEVSTRPEQVIGLHYFSPVDKMPLVEVIPHAGTSE
KTIATAVALAKKQGKTAIVVGDKAGFYVNRILTPYINEAGYCLVAGEPIDHIDKALVNFG
FPIGPINLLDEVGIDVGTKIIPILVEQLGNRFTAPDILAAILKDNRKGKKNRRGFYSYVS
KKGLLKFFSKGIKEVDESIYSLLKIKPAAKMSPADIAQRCVMLMLNEAVRCLDENIIRSP
RDGDIGAVFGIGFPPFLGGPFRYIDHLGSDKVVGILRHLESQYGERFTPCEGLIRMAEQK
KKFYS
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggctgaaaaagaagttgtcatcttaacaaagcaatcagatcgatccgtattc
aatttcgctgtcagagaggacaaagtaggcgtcattactattgatgtacccggcgagaaa
gtgaataccctgaaagccgagtttgttgaacagttcctgacgatgtttgagaaagcgcaa
caagtttccggtttaaaagggctggtgattatatccggaaagccggatacgtttattgct
ggtgcagatatcagtatgattgctggctgccaaacacaggaagaagcaacagaattagct
gaaaaaggtcaaaaactctttgcacagattgctaattatcctttaccgattgtggcagcg
gttcatggagcgtgtttaggtggtgggctagaattagcattagcttgccacgcacgaatc
tgttctttggatgaaagaacccgtcttggtttgccagaagttcagcttgggttattaccc
ggctcagggggaactcagcggctgcctcggttgattggtgtcagtgctgctttggacatg
atattgactggccgtcagcttaaggcaaaacaggcccagcggctgggtgttgtggatgat
gccgttcctttggagatcttgctggatgttgctgtgcaatatgctaaaaaaggcattatc
aaacgcaaaccattagcttggtcacaacgtataatggcgagtgcactgggcaggccacta
ctatttcatatggtgcatcaaaaaacacaagccaaaactcacggtcattatccggcacca
gaaaaaatcatcaatgtgatccgcacagggctggaaaaaggcgcgatacacggttttaag
actgaagccaaggcattcggcgagttggctatgtcaaaggagtcagaagcgttgcgaagt
ttgtttttcgcttcgacgacgttaaaaaatgaaactggctcgtcggaacaacctgctgaa
atcaagcaggtaggcattctgggtgggggattgatgggcggtggtattgctaatgttact
atgtccagaggcaatctacctgtccgcattaaagacattaacgaaaaaggtatcaatcag
gcactgaaatatacatgggatctgctgtctaagcgggtaaaacagcgccgtttaaaaccc
agtgagcgttcccgacaaatgtctctgttgaccggcactacagattacagcgggtttaag
caagcagatattgtcgttgaagctgtatttgaagatttgatactgaagcgcaaaatggtt
tcggaagttgaagacaacacaaaacctgacactatttttgcttctaatacttcttcttta
cccatccataaaattgctgaagtttcaactcggcctgagcaggtcattggtctccactat
tttagccctgttgacaaaatgcctctggtggaagttattccacacgcagggacaagtgaa
aaaacgattgctactgctgttgcgttggctaagaaacagggaaaaacagccattgtggta
ggagataaagccgggttctacgtgaaccgaattttgacaccttacattaatgaagcgggt
tactgcctggtcgcgggagaacccattgatcacattgacaaagcgcttgtgaatttcggt
ttccctattggtccaatcaatttgttggacgaagttggtatagatgtgggtactaaaatt
attccgatattagtagagcagttagggaatcggtttactgctccggatattttggcagcg
atcttaaaagataataggaaaggcaagaagaatagaaggggtttttattcctatgtgagt
aaaaagggcttgctcaaattttttagtaaaggaatcaaagaagtagacgaatctatttat
tccttattaaaaattaagcctgcggcaaaaatgtcaccggctgatattgcccaacgttgc
gtgatgcttatgctgaacgaagcggttcgctgtttggatgaaaatattatccgaagtcct
cgtgatggtgatattggggctgtatttggtattggatttccgccattcctgggtgggcca
ttccgttatattgatcatctgggtagtgataaggtcgtgggaattttacgccatttagag
tcacaatatggagagagatttactccgtgtgaggggttaatccggatggctgaacagaaa
aagaaattttactcataa

DBGET integrated database retrieval system