KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3807Help
Entry
XNC1_3807         CDS       T01274                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00240  Pyrimidine metabolism
xne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    XNC1_3807 (deoA)
Enzymes [BR:xne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     XNC1_3807 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N SH3_6
Motif
Other DBs
NCBI-ProteinID: CBJ91838
UniProt: D3VB63
Position
complement(3664426..3665766)
Genome map
AA seq 446 aa AA seqDB search
MFLAQEIIRKKRDGHPLSEEEIRFFINGVRDNTVSEGQIAALAMTIYFHDMTMEERVALT
LAMRDSGTVLEWKTLNLPGPVVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGFDIFPDEHRFRDTIRDAGVSIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILGKKLAEGLDALVMDVKVGSGAFMPTYEQSEQLAESIVKVANGAGCKTTALLT
DMNQVLASSAGNALEVREAVRFLTGEYRHPRLFEVTMALSVEMLVSGELASDRNDARRKL
QAVLDNGKAAEIFGRMVAAQKGPIDFVENYARYLPTADFRKPVLAGKNGIIAEMDTRALG
MSVVTLGGGRRKATDPINYSVGLSDIVTLGTQVNADTPLAVIHASSENAWYEAAEAVRNA
FVFEEKVFEETITKAATPLVYRQISG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggcacaggaaattattcgcaaaaaacgtgatggtcatccgctgagcgaagaa
gagatccggttctttattaacggagttcgtgataatacggtttccgaaggacagatcgct
gcattggctatgactatctatttccatgacatgacgatggaagagcgtgtcgcattgacc
ctggcaatgcgtgattccggtacggttttggagtggaaaacattgaacttacccggcccg
gttgttgataaacactcaacggggggagtgggagatgtcacttctctgatgcttggcccg
atggtggctgcttgtggcgggtacgtgccgatgatctcggggcgtggtttagggcatacc
ggtggaacactggataaattggagtccatccccggttttgacatttttcctgacgaacat
cgtttccgtgacacaattcgggatgcaggcgtttccatcatcgggcagaccaattcattg
gctcctgcggataagcgtttttatgccacgcgcgacattacagcaactgtagattctatc
cctcttattactgcgtcaatcttaggtaagaaactggccgaaggactggatgcgctggtg
atggatgtgaaagtcggttccggggcatttatgccgacttacgaacaatcggagcaactg
gctgaatcgatcgtcaaggttgccaatggtgcgggttgcaaaacaacagcactgctgacg
gatatgaaccaagttctggcatccagtgcggggaatgcgttggaagtgcgtgaagcagtc
cgattcctgacaggggaataccgtcatccccggttgtttgaagtgactatggcattgtct
gttgaaatgttagtttcaggtgagctggcaagtgatcgcaatgatgctcgtcgtaagtta
caagcggtactggataacggaaaagcggcagaaatatttggccgtatggtggcagcacag
aaaggcccgatagattttgtcgaaaattacgctcgctacctgccgactgcggatttcaga
aaacccgtattggctggaaagaatggcatcattgcagaaatggacacccgggcattgggc
atgtctgttgttacattggggggaggccgccgtaaggcgactgatcccattaattacagt
gtgggactaagtgatattgttacgctggggacacaagtgaacgcagatacccctctggcc
gtgattcacgccagtagtgaaaatgcctggtatgaagcggcagaagctgtgcgtaatgct
tttgtttttgaagaaaaggtttttgaggaaaccataacaaaagcggccacacctctggtt
tatcgccagatcagtggataa

DBGET integrated database retrieval system