KEGG   Xenorhabdus nematophila: XNC1_3875Help
Entry
XNC1_3875         CDS       T01274                                 

Gene name
fadB
Definition
multifunctional 3-hydroxybutyryl-CoA epimerase, delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase, enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
xne  Xenorhabdus nematophila
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_3875 (fadB)
   01212 Fatty acid metabolism
    XNC1_3875 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XNC1_3875 (fadB)
   00650 Butanoate metabolism
    XNC1_3875 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    XNC1_3875 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    XNC1_3875 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XNC1_3875 (fadB)
   00310 Lysine degradation
    XNC1_3875 (fadB)
   00380 Tryptophan metabolism
    XNC1_3875 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XNC1_3875 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XNC1_3875 (fadB)
   00281 Geraniol degradation
    XNC1_3875 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XNC1_3875 (fadB)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XNC1_3875 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XNC1_3875 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XNC1_3875 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     XNC1_3875 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3732677..3734863
Genome map
AA seq 728 aa AA seqDB search
MLYLSDTIQVKWLKDGIAELIFNAPAEINKLDTKTVTSLDKAVAALEQQTELKGLLLRSE
KQAFIVGADITEFLSLFNAPTEELHELLNLANNIFNRIEDLPVPTVSAINGYALGGGCET
VLSTDFRIASPDVRIGLPETKLGIMPGFGGSVRLPRLIGTDNALEIITAGKDIGAEEALK
NGLVDAVVPAAKLVDSAVSILEQAIKGDLDWKAARQPKLMPLNLNEIERTMSFSVAKGMV
MKIAGPHYPAPITAVKAIEKAATLSRDEALKLESDSFVTLAHTPVARALVGIFLNDQYVK
GLAKKHLQAVTTPEHAAVLGAGIMGGGIAYQSARKGIPVLMKDINQKALDLGINEAAKLL
NKQFERGRLEAMKMAKILSSIQPSLSYAGIEQSQIVVEAVVENPKIKAAVLAETESHISD
ECILASNTSTIPITELANSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDKTISTVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFRQIDKIMEKEFGWPMGPAYL
LDVVGIDTAHHAQAVMAQGFPDRMSRDYRDAIDVLFENQRYGQKNGVGFYQYTQDKKGKP
KKEQDETTDQLLAGISQPKQAFTSEEIIARTMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGVFRYLDTLGTAAYVKMAESYIHLGDLYQVPAGLKAKSESNESYYPAPAEL
AVNPGKKA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgctctacctaagtgacactattcaagtaaaatggctgaaagatggcattgcagaactg
atcttcaatgcaccagctgaaattaataaattagatacaaagacggtgacttcgctggat
aaagccgttgctgcccttgagcaacaaacagaactgaaagggttgttgttacgttctgaa
aaacaagcctttattgttggcgcagacatcacagaatttctatcattattcaacgcacca
acagaagaacttcacgaactactgaatcttgccaataatattttcaaccgtattgaagac
cttccagttcctacggtctctgccattaacggctatgctcttggtggtggttgtgaaaca
gtgctttctactgatttccgtatcgcctctcccgatgttcgtatcggattaccagaaacc
aaattgggcattatgcccggcttcggtggttctgtccgtctgccacgcttaattggtacg
gataacgctcttgaaattattactgcgggtaaagatatcggtgctgaagaagcattgaaa
aatggcttggttgatgctgttgttcctgctgcaaagctcgtggactctgctgtttcaatt
ctggaacaagccattaaaggtgatttagattggaaagcggcccgtcaacctaagctaatg
ccactgaatctcaatgagatcgaacgtactatgagctttagtgtggcaaaaggcatggta
atgaaaattgccggtcctcattatcctgcgccaatcactgcggttaaagccattgaaaaa
gcagcaacattaagccgcgatgaagcccttaaattagaatctgacagttttgttacactc
gctcatacccctgttgcccgtgctttagtcggcatcttcctgaatgaccaatatgtcaaa
gggctagccaaaaaacatttacaagcagtcacaacacctgaacatgcagcggtactcggt
gcagggatcatgggtggaggcattgcctatcaatctgctcgcaagggcatccctgtcctg
atgaaagacatcaatcaaaaggcgttggatttaggtatcaatgaagcggctaaattactg
aataagcaatttgaacgcggacgtttggaagccatgaagatggctaaaatcttgtcatcc
attcagccaagcctcagctatgctggcattgaacaatcccagattgttgtcgaagctgtc
gttgaaaatcccaaaattaaggctgctgttttagcagaaacagagtctcatatcagcgat
gagtgcattctggcgtctaatacctccacaattccaatcaccgaattagcaaactcgctg
aaacgcccagaaaatttctgtggaatgcattttttcaatccagtacatcgtatgccactg
gttgaaattattcgtggagaaaagacatcagataaaaccatttcaacggttgtcgcttac
gccagcaaaatgggtaagacaccgattgtcgtcaatgactgccctggcttctttgtaaac
cgcgtcttgttcccgtatttggctggttttggcatgttagtccgtgatggcggtgatttt
cgtcaaatcgacaaaatcatggaaaaagagtttggctggccaatgggccctgcttatctc
cttgatgttgtcggtattgatacagctcaccatgcacaggctgttatggcgcaaggcttc
cctgatcgtatgagccgagattatcgggatgccattgacgtattattcgaaaatcaacgt
tatggccagaaaaatggtgttggtttctatcaatatacccaagataaaaaaggcaaaccg
aaaaaagagcaggatgaaactaccgatcaactcttggcaggcatcagtcaaccaaaacag
gctttcaccagtgaagagatcattgcgcgtaccatgatcccaatgattaacgaagtcgtt
cgttgtttggaagaaggtatcattgccagcccagcggaagcagatatggcgctggtttat
ggtttaggcttccctccattccacggcggtgttttccgttatctggataccttggggact
gcggcctatgtgaagatggctgaaagttatatccacttgggtgatctctatcaagtacct
gctggcctgaaagcaaaatccgaaagcaatgaaagttattaccctgccccagcagaactt
gctgttaatccaggcaaaaaagcgtga

DBGET integrated database retrieval system