KEGG   Xenorhabdus nematophila: XNC1_3909Help
Entry
XNC1_3909         CDS       T01274                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xne  Xenorhabdus nematophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_3909 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_3909 (glk)
   00052 Galactose metabolism
    XNC1_3909 (glk)
   00500 Starch and sucrose metabolism
    XNC1_3909 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XNC1_3909 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XNC1_3909 (glk)
   00524 Butirosin and neomycin biosynthesis
    XNC1_3909 (glk)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XNC1_3909 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3770763..3771731
Genome map
AA seq 322 aa AA seqDB search
MTTYALVGDIGGTNARLALCDVDTGQQSAVEFYPCAHYESLEIVIRQYLQKQNCEVKYGC
IAIACPVTEDVISMTNHSWRFSVSQMKASLQWERFEVINDFTAVSLAIPVLGANDVIQIG
GKQPQAKRPIAVYGAGTGLGVAHLIHTGNQWMSLPGEGGHVDFAPDSVEEDHMLNVLRKE
YGHVSAERILSGPGLVNIYRSLMTLNGQPIEVLTPSDISDRALSGNCPICKHALELFCSA
LGRFGGNLALNIGAFGGVYIAGGIVPRFLDFFQKSAFRKAFESKGRFTNYLQDIPVYLIT
HDKPGLLGTGSYIRQSLGKTIG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatgccctggtaggcgatatcggcggtacaaatgcacggctggcattatgt
gatgtagatactgggcaacagagcgcagtcgaattctatccctgtgcgcattacgaatca
cttgaaattgttattcgccaatacctgcaaaaacagaactgtgaagtcaaatatggttgt
atcgccattgcctgtccggtgacagaagatgttatcagtatgaccaatcatagttggcgt
ttctctgtcagccaaatgaaagcatctctgcaatgggagcgttttgaggtcatcaacgat
tttaccgcggtttctctcgccattccggttctgggggcaaatgacgtgatccagattggt
ggaaaacagcctcaggctaaacgacccatcgcggtttatggtgcaggaacagggttgggc
gtcgcacatcttattcacacaggaaatcaatggatgagcctgcccggtgaaggtggtcat
gtcgattttgcgcctgatagtgtggaagaagatcatatgctgaatgtattgcgcaaagaa
tacggtcatgtctccgctgaacgcatcctttcagggcctggattggtcaatatctatcgt
tctctgatgacactgaatggtcaaccaatagaagtacttaccccgagcgacatttccgat
cgtgccctgagcggaaactgccctatctgcaaacatgcactggaactattctgctcggca
ctgggtcgttttggcgggaatctggcactgaatattggcgcatttggtggtgtttatatt
gcaggtggtattgtcccgcgcttccttgatttcttccaaaaatcggcgttccgcaaggca
tttgaaagcaaaggccggtttacaaattatttgcaggatattcctgtttatctgattacc
cacgataaacccggattattgggtacgggttcttacatccgtcaatcgctgggtaaaacg
attgggtaa

DBGET integrated database retrieval system