KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3949Help
Entry
XNC1_3949         CDS       T01274                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_3949 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XNC1_3949 (aceA)
Enzymes [BR:xne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XNC1_3949 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3812948..3814255)
Genome map
AA seq 435 aa AA seqDB search
MTISRTQQIAQLEQEWKQPRWQGITRPYSAEDVIKLRGSVNPEHTLAQIGAKKLWESLHG
KSKKGYVNALGALTGGQALQQAKAGIEAVYLSGWQVAADANTASSMYPDQSLYPVDSVPN
VVKRINNSFRRADQIQWSNGIDSGSQEYIDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVSGVPTLLIARTDADAAD
LITSDCDPYDSEFITGERTCEGFYRTRAGLDQAISRGLAYAPYADVIWCETSTPDIGAAR
RFAEAIQAKYPGKLLAYNCSPSFNWKKNLDDKTIASFQAQLSAMGYKFQFITLAGIHSMW
FNMFDLAYDYARGEGMKHYVEKVQEQEFAALERGYTFSSHQQEVGTGYFDKVTTIIQGEA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttcccggacacaacaaatcgctcagttagaacaagaatggaaacaaccgcgc
tggcagggtattactcgtccatatagtgcagaagatgttatcaaactacgtggttctgtt
aaccctgaacatactttagcgcaaataggagcgaaaaagttgtgggaatcgttgcatggc
aaatcgaaaaaaggctatgtaaatgcacttggtgcgctgacaggaggacaggcacttcaa
caagcaaaagcaggtattgaggctgtttatctttcaggctggcaagttgcagcggatgcc
aataccgcttccagcatgtatcccgatcaatcattatatcctgttgattctgtacctaat
gtcgtcaaacgaatcaataacagttttcgtcgtgcagatcagatccagtggtcaaatggc
atcgattctggcagtcaggaatatatcgattattttctgccgattgtggctgatgcggag
gcgggatttggtggcgtattgaacgcatttgagctgatgaaagcaatgattgaggccggt
gccgcggcagttcatttcgaagatcaattggctgcggtgaaaaaatgtgggcacatgggg
ggtaaagtgttggttccgactcaagaagccatccaaaaacttgtcgctgcacgattggcg
gctgacgtatctggagtacctacgctactcattgcccgtactgacgcagatgcagcagac
ttaataacatctgattgtgatccttatgatagcgaattcattacaggtgaacggacctgt
gaagggttctaccgtactcgtgctggccttgatcaggctattagccgtggtttggcatat
gccccttacgctgatgttatttggtgtgaaacctcgactccggatataggggcggctcgc
cgttttgccgaagctatccaggcaaaatatccggggaaattgctggcatataactgttcc
ccgtctttcaactggaaaaagaatctggatgataaaacgatcgccagttttcaggcgcaa
ttgtctgccatgggctataaattccagttcattacactggcgggcatacacagcatgtgg
tttaacatgtttgatttagcttacgattatgcgcgcggcgaaggcatgaaacactatgtt
gaaaaagtgcaggagcaagaatttgcagctcttgagcgtggttatactttctcatcccat
cagcaggaagtgggaacgggatattttgataaagtgaccaccattattcagggagaagct
tcttctgttaccgcattgacgggatcgacggaagaacagcaattctaa

DBGET integrated database retrieval system