KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3950Help
Entry
XNC1_3950         CDS       T01274                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_3950 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XNC1_3950 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    XNC1_3950 (aceB)
Enzymes [BR:xne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XNC1_3950 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3814318..3815913)
Genome map
AA seq 531 aa AA seqDB search
MQQMLTTQLTFIKPFGEVENQVLSPESINFLEDLVAGFSDRRKKLLEERVDWQKKVDDGV
LPNFISETFSIREGDWKIQGIPDDLNDRRVEITGPVERKMVINALNANVKVFMADFEDSL
APAWDKVISGQINLRDAVNGTISYTSEQGKRYELKPEPAVLIARVRGLHLPEKHVLYMNE
PISGGLFDFALYFFLNHKKLLEKGSGPYFYLPKIQSYQEAQWWSDVFSFTESRFNLPKGT
IKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHVDRVLPDRQSVT
MTQPFLSAYSRLLIKTCHKRGAFAMGGMSAFIPSKDPEQNQQVLDKVRVDKELEANNGHD
GTWVAHPGLADIAMRVFDTKLGEQPNQLAILREEDETITAEQLLAPCPGERTEQGMRANI
RVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHEKSLSNGKKVTKTLFREM
LKEELSVIKQEIGGSHFNQGRFMEASALMEKITTQDDLIDFLTLPGYQLID
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaatgttaacaacccaattaacctttataaagccttttggtgaggtagaaaat
caggtgttatcacctgaatctattaattttttagaagatttggttgccgggttttctgac
aggcgtaaaaagttattggaagaacgcgtagattggcagaaaaaagtagatgatggagta
ttacctaattttatttcggaaacattttccattagagaaggtgattggaagattcaggga
atacctgatgaccttaacgatcgccgtgttgaaataaccgggcctgtagagcgtaagatg
gtcattaatgccttaaatgcaaatgtaaaagtatttatggcagattttgaggattcactg
gctcctgcgtgggataaagttatcagtgggcaaattaacctgcgggatgctgtcaatggt
acgatttcatataccagcgaacagggaaagcgttatgaattgaagccggaacccgcagta
ttgattgcccgggttagggggcttcacttgcctgagaaacacgtactctacatgaatgaa
cccatttctggtggtttatttgatttcgctttgtatttcttcttgaaccataagaaattg
ctggaaaaaggcagcggcccttatttttatctgcctaaaatccaaagctaccaagaagca
cagtggtggagtgacgtttttagttttacagaatcgcgtttcaatttacctaaaggtacc
attaaagccacggttttgattgaaacattaccggctgtatttcagatggatgaaattctt
tatcacttacgtcaccacattgttgggcttaattgcggtcgttgggattacattttcagt
tatatcaaaacactgaaaaatcatgttgatcgcgttttacccgatcgtcagtctgtgacg
atgacacaacctttcctgagtgcctattctcgcttgttgattaaaacctgccacaaacgc
ggggcatttgcgatgggtggtatgtcggcatttattcccagtaaagatcctgagcaaaac
cagcaggtattagacaaagtcagagtagataaagaactggaagcgaataacggtcatgac
ggaacatgggtagctcatccggggcttgcagatattgctatgagggtttttgacacaaaa
ctgggtgagcagccaaaccaattggcaattttgcgtgaggaagatgaaacgattacggct
gaacaattgcttgctccttgcccaggagaaagaacagaacaaggcatgcgcgctaatatt
cgtgtcgctgtccaatatatagaagcatggatttcaggaaatggatgtgtgccgatttat
ggcttgatggaagatgctgcaacagcagagatttcccgtacttctatttggcaatggatt
cgccatgaaaaatcactttccaatggtaaaaaagtgactaaaacgctattcagagaaatg
ttaaaagaagagctaagtgtgattaaacaagaaattggtggaagtcacttcaatcaaggg
cgcttcatggaagcttctgccttgatggaaaagattaccacacaggatgacttaattgat
ttcttaaccttgccaggttatcaactaattgattaa

DBGET integrated database retrieval system