KEGG   Xenorhabdus nematophila: XNC1_4286Help
Entry
XNC1_4286         CDS       T01274                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xne  Xenorhabdus nematophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XNC1_4286 (malQ)
Enzymes [BR:xne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     XNC1_4286 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4124756..4126906
Genome map
AA seq 716 aa AA seqDB search
MENKSLDHLATEAGIASEYINAYGKPQAIPAEIRHRILEAMSMNIPVERPVSSRMPALPN
VKVITQGQTATLPLNEAGNYQWQIYTEQGEIFHGHCQQQFTLPIGLPLGYHTLTLIPEVE
QENRPQQQSIQLIVAPERCYEPKALTQGGKLWGACVQLYTLRSENNWGIGDFGDLKSMLQ
ELAQHGGAFVGLNPLHAIYPAMPENASPYSPSSRHWLNIIYIAVNQVEDFKQSACAQAWW
QSPATQKKLQQAREAEWVDYTTVMTLKMDALRLAYPQFKRLPDDDLRHINFQEFVLKGGT
NLYSQAVYDALHHQLYRENNTYWGWPVWPEKYREPDSEAVKAFCHSHPQEVAFFLWLQWL
ADTQLAECFTTSQNNNMSIGIYRDLAVGVAQGGAETWCNRTIYCTKASIGAPPDILGPRG
QNWGIPPMNPHILKVQAYQPFIELLRSNMRHCSALRIDHVMSLLRLWWIPQGETADKGVY
VYYPVDDLLAILALESQRNHCMVIGEDLGIVPEEIVDKLRERGVYSYKVFYFERNEHGEY
RSPNEYPVQAMATITTHDLPTLRGFWQGRDLTLGESIGLYPDKTLLAELYAERKRCKQAL
LESLDRHGYLSELNPLLKENIPLSLQQTTLQEQAEQTMSASINLGVHCYTAHSNCALLGL
QPEDWQDMANPVNIPGTTTEYPNWRRKLTRTLEAMFADKQINQLLQTVSEYRKQNS
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaagcctcgatcatttggcaacagaggctggcattgccagcgaatacatt
aatgcctatggcaaaccacaggccattccggctgaaatcaggcaccgaatactggaagcg
atgagcatgaatataccggtcgaaagaccggtttcttctcgtatgcctgctttacctaac
gtaaaagtgattactcaaggacaaacagccaccctgcctctgaatgaggcaggaaattac
caatggcagatatatactgaacaaggcgaaatatttcacggccattgccaacagcaattc
acattgccaatcgggcttcctttgggataccacacgctgacactcataccagaagtggaa
caagaaaaccgtcctcaacaacaatcaatacaacttattgttgctcccgaacgctgctac
gaaccaaaagcgttaacacaaggtggaaaactctggggtgcctgtgttcagctttatact
ctgcgttcagaaaataactggggaattggtgattttggtgacctgaaatctatgctgcaa
gaactggcacaacatggtggcgcctttgtcggcttaaatcctctacatgccatatatcct
gcaatgcccgaaaatgccagcccttacagcccatcttcccgtcactggcttaatatcatt
tatattgccgtcaatcaggtagaagattttaagcagagtgcttgcgcccaagcatggtgg
caatcacccgcaacacagaaaaaactccaacaagcccgtgaagcggaatgggtcgattac
accacagtgatgacactgaaaatggatgcacttcgtctggcttacccacaatttaagcgc
ctacctgacgatgacctgcgacacatcaattttcaggagtttgtacttaaaggggggacc
aacctttactctcaagcagtttatgatgcccttcaccatcaattatacagagaaaataat
acttactggggctggcctgtatggccggaaaaataccgtgagccagacagtgaagcggtt
aaagcattttgccattcacatccacaggaagtcgcgtttttcctttggttgcagtggctg
gccgatacacagcttgccgagtgttttacgacaagccagaataataatatgtcaatcggt
atttatcgtgatctcgctgtaggtgtcgcacaagggggagcagaaacatggtgtaaccga
accatttactgcactaaggcatcaataggtgctccccctgatattttagggccacgagga
caaaactgggggattccgccgatgaatccccatatattgaaagttcaagcctatcaacct
ttcattgaattactccgcagcaatatgcgccattgcagcgcattgcgcattgaccatgtc
atgtcgctactcagactctggtggataccacaaggggaaaccgccgataaaggcgtatat
gtctattatccggttgatgatctgctggcaatcctcgcgctggaaagccaacgtaatcat
tgcatggtgattggcgaagatttaggcattgtaccggaagaaattgtcgataaactacgg
gaacgaggggtgtactcctataaggtattttattttgaacgaaatgagcacggtgaatat
cgttcccccaatgaatatcctgtacaagcgatggcaaccattaccactcatgatttaccc
accttacgcggattctggcaaggcagggatctgacattaggtgagtccattggcttatat
cctgataaaacactgcttgctgagctatatgctgaacgtaaacgttgtaagcaggcattg
ttggaaagtttagatcgacacggttatctatcagaactaaacccgttacttaaggaaaat
atcccgctttccttacaacagaccacattacaggagcaagctgagcagaccatgtcagcc
tctatcaatctcggggtacactgctatacagcccatagcaattgtgccttattaggattg
caacctgaagattggcaggatatggcaaatcccgtcaatattcctgggaccacaacagaa
tatcctaactggcgacgcaaactcacccgtactctggaagccatgtttgcggataaacag
atcaaccaattattgcaaacagtaagcgaataccggaaacaaaactcataa

DBGET integrated database retrieval system