KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4621Help
Entry
XNC1_4621         CDS       T01274                                 

Gene name
paaF
Definition
enoyl-CoA hydratase-isomerase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XNC1_4621 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XNC1_4621 (paaF)
   00650 Butanoate metabolism
    XNC1_4621 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    XNC1_4621 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XNC1_4621 (paaF)
   00310 Lysine degradation
    XNC1_4621 (paaF)
   00360 Phenylalanine metabolism
    XNC1_4621 (paaF)
   00380 Tryptophan metabolism
    XNC1_4621 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XNC1_4621 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XNC1_4621 (paaF)
   00281 Geraniol degradation
    XNC1_4621 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XNC1_4621 (paaF)
   00627 Aminobenzoate degradation
    XNC1_4621 (paaF)
   00930 Caprolactam degradation
    XNC1_4621 (paaF)
Enzymes [BR:xne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XNC1_4621 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4414749..4415522
Genome map
AA seq 257 aa AA seqDB search
MSQEWILCHQQQRVRTLTLNRPEVRNALSNDCLELLVNQLELADRDNGTGAIVITGSSRC
FAAGADLKELQQQTVATAITDRRPQLWQRLNNINKPLIAAVNGYALGAGCELALTCDLVI
CGENARFGLPEITLGLIPGAGGTQRLIRCVGKALASQMILTGEAINARQAQQTGIVSEVC
GDELTLERAEQIAQRISELSPLALRAAKAALKTAQETSLSQGLLAERQQFVALAGTTDRQ
EGIAAFLEKRKPTFKGF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatggattttatgccaccagcagcaaagagtacgcacactgaccctcaac
cgtcctgaagtgcgtaacgccctcagtaatgactgtcttgagctgcttgttaatcaatta
gagctggcagacagggataacggcaccggtgccattgtcattaccggttcatcacgctgt
tttgctgccggtgccgatctgaaagaactccagcaacaaaccgtggcaaccgccatcacc
gatcgccggccacaactttggcaacgcctgaacaacattaacaaaccgttgatagcggcc
gtaaatggttacgcgctgggcgcgggctgtgaattggcgctgacctgtgatcttgtgatt
tgtggggaaaacgcccgtttcggcctgcccgaaattaccctggggctgatacccggcgcg
ggagggacacagcgtctcatccgctgcgtcggcaaagcactggcttcccagatgatcctg
accggtgaagccatcaacgcccggcaggcacaacaaacggggatcgtcagcgaagtgtgc
ggcgatgaactaacactggagcgggcagaacagatcgcacaacgtatcagtgaactgtcg
ccgctggcactgcgggcagccaaagcggcactaaaaaccgcacaggaaaccagcctgtca
caagggttgctcgccgagcgccagcaatttgtcgcgctggcaggtacaaccgatcgtcag
gaaggcattgccgcctttctggaaaaacgtaaaccaacatttaaaggattttga

DBGET integrated database retrieval system