KEGG   Xenorhabdus nematophila: XNC1_p0027Help
Entry
XNC1_p0027        CDS       T01274                                 

Definition
DsbC protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xne  Xenorhabdus nematophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XNC1_p:24900..25607
Genome map
AA seq 235 aa AA seqDB search
MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVKLPIKGVRAVQSDGQIMFLSE
NGRFVISGQIYDLWSKKPLNTMSQMRDVAERIHFKNMGMDVDTLNTLSMGHGDKEVVVFV
DPRCAVCHKLMDESKSLADEYTFKIVVIPALGAESNRLAKNLYCAEDKTHALDALMNNTL
GTLSSKENCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKGRPKNLKSWLESAE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaaaattacttggggcgctgatggtgttcgggattattaccggcactgctcat
gcgtcatcgaaattggaaatcaccgatccaagagctgcaaagatagaggacatcgtgaag
ctgcccattaagggggttcgagctgttcagagtgacggacaaataatgttcctttccgaa
aacgggcgttttgttatttcaggacaaatctatgacctgtggagcaaaaagccactcaac
acgatgtcccagatgcgcgatgtggcagagcgtattcacttcaagaacatgggcatggac
gtggacacgctgaacaccctctcgatggggcatggtgacaaagaagtcgtggtatttgtc
gatccccgatgcgctgtttgccacaagctcatggacgagtccaagtcgctggcagatgag
tacaccttcaaaatcgtcgtaatccccgctctgggagctgagtctaatcgactcgccaag
aacttgtactgcgcggaagacaagactcatgcgctcgatgcgctgatgaataacaccttg
ggcacactttcttcaaaagaaaattgcgaccccggtcagtatgaccaaacgctgttgaca
gcccacttcattgggattgaaggagttccgttcgttgttgctcccgatggccgcgttagt
aaaggacgcccaaagaacctgaaatcatggttggagagtgctgaatga

DBGET integrated database retrieval system