KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0057Help
Entry
XOO_0057          CDS       T00360                                 

Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Brite
Enzymes [BR:xom01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     XOO_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56420..57466
Genome map
AA seq 348 aa AA seqDB search
MSRQIIISIFLTVVLLLLGVRWLAGLDLDQGERRQATVALGNTLFQDTTLSARRTLACSS
CHDPSKAFAQDIAVPIVYGQRTGTRNVPSLLDLPYFTHFFWDGREEKLERVAVAAFTNQA
EMAQPDMSVLIKAVSQRLDYRTQFKAAFGDERVDQERISSAILAYLASVTTGRSRYDAFV
AGNTTALTTAERRGLDVFRGKADCSSCHALNGTPAAFTDNRFHHSNVGMDRMAGQISTTI
ESFKTKREQGVPVAELVLSDPDMAALGRFAISGQGNDLAAYRTPTLRNVTRTPPYMHDGS
VQNLEEAIQREIYYRSLSRGTPISLTAGEKNDLYAFLHALEDLPNNAH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacaaatcatcatctccatcttcttgaccgtcgtattgcttttgctgggcgta
cgttggctggcgggattggatctggatcaaggagagcgccgtcaagccacggtagccctg
ggtaacaccctgttccaggacaccactctcagcgcgcgtcggaccctggcctgcagctcg
tgccacgatccaagcaaggcattcgcccaagacatcgcagtccccattgtctatggtcag
aggaccggcacccggaacgtaccaagcttattggaccttccttacttcactcatttcttc
tgggatggtcgcgaggaaaaactggagcgagtagcggtggcggccttcaccaatcaggcc
gaaatggctcaaccggatatgagtgtgttgatcaaggcggtgtcacaacggctggattat
cgaactcaattcaaggcagcgtttggcgatgagcgggtcgatcaggaacgtatctctagt
gccatcttggcttacttggcgtccgttacgactggtcgcagccggtacgacgctttcgtc
gcgggaaacaccaccgccttgacaacggcagagcgccgcggcctggatgtgttccgcggg
aaagccgactgctcttcatgccatgccttaaacggtactccagccgctttcacggacaac
cgatttcaccattccaacgtcgggatggatcggatggctggacaaatcagcactaccatt
gaatcttttaaaaccaaacgcgagcagggtgttccagtcgctgagctcgtactgtcagat
ccagacatggccgcactgggacgatttgcaatcagcggccaaggcaatgacttggcggca
taccgaaccccaaccttacgcaacgtcacccgtacgccaccctacatgcacgatggcagc
gtgcaaaaccttgaagaggcgatccagcgcgagatctattaccgcagtctttcgcgcggc
actcctatctcattgacggcaggagaaaagaatgatctgtacgcattcctgcatgcgctt
gaagacctgcccaacaacgctcattaa

DBGET integrated database retrieval system