KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0063Help
Entry
XOO_0063          CDS       T00360                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOO_0063
Enzymes [BR:xom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     XOO_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(64002..65951)
Genome map
AA seq 649 aa AA seqDB search
MSTRAPGSEDLDALAAAAGVMVDWVDASDQPRHVSEQSVHAVLTALELPAATAAQRADSL
RRCQAQAAEPAPLLTVQVGELLPLRVAANTIGRWTDDSGASEDARTDARGQLRAPPRFGY
WTLQIGAITQHVAVAPRRCFSVADACGQASPRAWGMALQVYSARSLDDGGIGDAAGTVEW
LRHATLAGADALALSPVHASRPVTGAYSPYSPSDRRFLDPLHAAPVRILGELALDAINAV
PGLRERFDRLHDGALIDWQASAHAKWELLRQLYTRVAPDHADLVAFGNADGAALQGFARF
AAQDFGDNDPQLHVFTQWLAARSWSDAQRQAHERGMKIGLIADLAVGFDPNGAEAAAAAD
TVLRGLVLGAPPDAFNADGQHWGIGAYSPTALRRSGYAPYIALLRAVLRDRGGIRIDHIL
GLMRLWVVPDGASSNEGAYLAYPLHDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSR
RGVMGIDVLMFTRDDDGAFVSPALWRPDAIATTTTHDLPTLTGWREGRDIAWRRKLALIQ
PAQASDDAKARIKDVARLEAAVEHAGLSSAHDPLLGALRFTAASVSPLALLPVEDALALD
EQPNLPGTVEVHPNWRRRLPDPLPHARLSSALQGFAEARRVAAVSEPHP
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacgcgtgccccgggcagtgaggacctcgacgccctggccgctgcagccggggtg
atggtggattgggtggatgccagcgaccagccgcggcatgtgtccgagcaatcggtgcat
gccgtgctcaccgcgttggaattgcccgccgccaccgcggcgcaacgcgccgacagcctg
cgccgctgccaggcacaggccgccgagccggcgccgctgctgacggtgcaggtgggtgag
ttgctgccattgcgcgtggcagccaatacaatcggccgctggaccgacgacagcggtgcc
agcgaagacgcccgcacagatgcacgagggcaactgcgcgcgccgccgcgtttcggttac
tggacgctgcagatcggcgcgatcacccagcacgtggccgtggcaccgcgccgctgtttc
agcgtggccgatgcctgtggccaagcatcgccgcgtgcctggggcatggcgctgcaggtg
tattcggcacgcagcctggatgacggcggtatcggcgatgctgccggcacggtggaatgg
ctgcggcacgcgaccttggccggcgccgacgccctggcattgagtccggtgcacgcctcg
cgcccggtgacgggcgcctacagcccgtattcgccgagcgatcggcgctttctcgatccg
ttgcatgccgcaccggtgcgcatcctgggtgaactggcgctggatgcaatcaacgcggtg
cccggtctgcgcgaacgtttcgatcgcctgcacgatggcgcattgatcgattggcaggcc
tcggcgcacgccaagtgggaattgctgcgccagttgtacacgcgtgttgcgcccgatcat
gccgacctggtcgcattcggcaacgcagacggcgcggcgctgcagggctttgcacgcttt
gctgcgcaggatttcggcgacaacgatccgcagttgcatgtgttcacccaatggctggca
gcgcgcagctggtccgatgcgcaacgccaggcgcacgagcgcggcatgaagatcgggttg
atcgccgatctggcggtcggcttcgaccccaatggcgccgaagccgcagcagcagcagac
accgtgttgcgcgggctggtgctgggcgcgccaccggatgcgttcaatgccgatggtcag
cattggggcattggcgcgtactcgcccaccgcattgcgacgcagcggctacgcgccgtac
atcgcactgctgcgcgcggtgttgcgcgaccgtggcggtatccggatcgatcacatcctg
ggcctgatgcggctgtgggtggtgcccgatggcgccagttccaacgaaggcgcgtatctg
gcgtacccgttgcacgatctgctcaatctgctcgcgctggaatcgtggcggcatcgcgca
attgtcatcggcgaggatctgggcgtggtgccgccgggcatccgcgaagaactgtcgcgg
cgtggggtcatgggcatcgatgtgttgatgttcacccgcgacgacgacggcgcgttcgtc
tcgccggcgctatggcggccggatgcgatcgccaccaccaccacccacgacctgcccacg
ctcactggctggcgcgaaggccgcgatatcgcatggcggcgcaagctggcattgatccag
cctgcgcaggccagcgatgacgccaaagcgcgcatcaaggacgtggcacggctggaagcc
gctgtcgaacacgccggcctgagcagtgcgcatgacccgctgctgggcgcattgcgtttc
accgccgccagcgtctcgccactggctttgttgccggtggaggatgcgctggcgctggac
gaacaacccaatctgccgggcaccgtcgaagtgcatcccaactggcgtcgacgcctgccc
gatcccttgccgcatgcgcgcctgagttcggcgctgcagggctttgccgaggcgcgtcgc
gtcgcggccgtttcggaaccgcatccatga

DBGET integrated database retrieval system