KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0065Help
Entry
XOO_0065          CDS       T00360                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOO_0065
Enzymes [BR:xom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XOO_0065
Exosome [BR:xom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOO_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(67708..69942)
Genome map
AA seq 744 aa AA seqDB search
MSERQGGQEQDREADGVTTEGISEMSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLA
PGAEAMGLIDSRGKLLARMQASAIDGVFEGILSIEGPYRLRIVWPDMVQEIEDPYAFAVT
LDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNGWDVRRH
PMRQRIGGFWELFLPRVEAGPRYKYAVTAADGRVLLKADPVARQTELPPATASVVPGTDT
FAWTDAAWMAKRDPSAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTH
IELLPITEHPFGGSWGYQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPD
DAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIDHYHLDGLR
VDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAW
PGVTAAISDGGLGFTHKWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPI
SHDEVVHGTGGLLGQMPGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQS
LDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGTHRAKGFDWSVADDARNSVLAFIRHD
PDGGGVPLLAVSNLTAQPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMG
MHGHAQRLRLTLPPLATIYLQAEK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacggcagggcgggcaggagcaggacagggaagcagacggcgtgaccacggaa
gggatctcggagatgtcgcagaccctgcaagcgctggccgatggattgccggtcgacgcc
tttgcggtccttgggccgcacccgctcgccgatgggcgccgccaagtgcgtgtgctggcg
ccgggggccgaggcgatggggttgatcgactcgcgcggcaagttgctggcacgcatgcag
gctagcgcgattgacggcgtctttgaaggcatcctgtcgatcgaagggccgtaccggctg
cgcatcgtgtggccggacatggtgcaggagatcgaagacccgtacgcgttcgcggtcaca
ctggacgaatcgctgttgctgcagatcgccgctggcgatggtcaggcgctgcgccgcgcg
ctgggcgcgcagcatgtgcaatgtggcgaagtgcccggcgtgcgctttgcagtgtgggca
ccgcatgcgcaacgcgtggccgtggttggtgacttcaatggctgggacgtgcggcggcac
ccgatgcgccagcgtatcggcggcttctgggaactgtttctgccgcgcgtggaagctggc
ccgcgctacaagtacgccgtcactgcagccgatggccgcgtgctgctcaaggccgacccg
gtggcgcggcaaaccgaattaccgccggccaccgcctcggtggtgcccggcacggacacc
tttgcgtggaccgacgcggcctggatggccaagcgcgatcccagcgccgtgccggcgccg
ctgtcgatctacgaagtgcatgccgcgtcctggcgccgcgacggacataaccagccgctg
gactggccaaccctggccgagcaactgattccctacgtgcagcagctccgcttcacccat
atcgaattgctgccgatcaccgagcacccgttcggcggttcctggggctaccagccgctg
ggcctgtatgcgcccaccgcccgccacggcagtccggacgggtttgcgcagttcgtcgac
gcctgccaccgcgctggcatcggcgtgatcctggactgggtcagcgcgcacttccccgat
gacgcgcatgggctggcgcagttcgacggcgccgcgctgtatgagcacgccgaccctcgg
gaaggcatgcatcgcgactggaacaccctgatctacaactacggccggccggaagtgacc
gcctacctgctggggagcgcgctggagtggatcgaccattaccatctcgacggcctgcgc
gtggatgcggtggcctcgatgctgtaccgcgactacggccgcgccgaaggcgagtgggtg
cccaacgcgcatggcggccgcgagaatctagaggcagtggcgttcctgcgtcagctcaac
cgcgagatcgccgcacacttccccggcgtgctcaccatcgccgaagaatccaccgcctgg
ccgggcgtgaccgcggcgatcagcgatggcggcctgggcttcacgcacaaatggaacatg
ggctggatgcacgacacgctgagctatatgcagcgcgatccagccgaacgtgcgcatcac
catagccagctcaccttcgggctggtgtacgcattcgacgagcggttcgtcttacccatc
tcgcacgatgaagtggtgcacggcaccggtggcttgctcgggcagatgccgggcgacgac
tggcgccgcttcgccaacctgcgcgcgtatctggcgctgatgtgggcgcacccgggcgac
aaactgctgttcatgggcgccgaattcggtcaatgggccgattggaatcatgaccagtcg
ctggattggcatctgcttgaaggcgcgcgccaccgcggcgtgcagctgctggtgggcgac
ctcaacgccacgttgcgtcgcactcccgcgttgtatcgcggtacccatcgcgccaaaggt
ttcgactggagcgtggccgacgacgcgcgcaacagcgtcttggccttcatccgccacgat
cctgacggcggcggcgtgccgctgctggcagtgagcaacctcaccgcgcaaccgctgcac
gactatggcgtgggcgtgccgcgcgccggcgcctggcgcgaaatcctcaacaccgacagt
gcccattacggtggcagcaacctcggcaacagcggtcgtcttgcgactgagccgatgggc
atgcatgggcatgcgcaacgcctgcgcctgaccctgccgccgctggccacgatctatctg
caagcggagaaatag

DBGET integrated database retrieval system