KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0253Help
Entry
XOO_0253          CDS       T00360                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xom00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276781..277854
Genome map
AA seq 357 aa AA seqDB search
MFRTPPHFPRLRTAALALTLLAATPLVQAKEPPGSKKETAGLKYVGVNLSGAEFNSRKKP
GTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPALNGPLDQAQLGLIKKSLEAAKA
NKQYLILDLHNYATYNGKRIGTSDVPASALADLWRRLALEFKDDKAVIFGLMNEPNGISA
PDWANAAQGAINAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALQILKDPGNNMA
FEAHQYLDKDYSGTKPVCTSDSVGQEKLEGFTSWLRENKQKGFLGEFATANNPVCDKALE
GMLTYMQKNSDVWLGWTWWAAGSWWKPDYAFTVQPGKDGSDKPQMAILSKYARRAGK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcactcccccgcacttcccccgcttgcgcaccgccgcgctcgcgttgaccttg
ctcgctgccaccccattggtccaggccaaggagccgcctggctcgaagaaggaaaccgct
ggcctgaagtatgtcggcgtcaatctgtccggcgccgagttcaactcgcgcaagaaacct
ggcaccttgttcaaggactacacctatcctgccgcctcggacttcagctatttcgccggc
aaaggcatgaatacgatccgcctaccgttcctgtgggagcgcgtgcagcccgcgctcaat
ggcccactggaccaggcccaattgggcttgatcaagaaatctctggaagcagccaaggcc
aacaagcagtacctgatcctggacctgcacaactacgccacgtacaacggcaagcgcatc
ggcaccagcgatgtgccggccagcgcattggccgatctgtggcgccggctggcgctggag
ttcaaggacgacaaggcggtgatcttcgggctgatgaacgagcccaacggcatttccgca
cccgactgggccaatgccgcgcagggggcgatcaacgcgatccgcaagaccggcgcgaag
aatctgatcctggtgccaggcacggcgtataccggcgcacacagctggcgcagcaccagc
tacggcgtctccaatgcaaaggcgctgcagatcctcaaggacccgggcaacaacatggcc
ttcgaagcgcatcaatacctggataaggactacagcggcaccaagccggtgtgcaccagc
gactcggtaggccaggaaaagctggagggcttcacctcgtggttgcgcgaaaacaagcag
aagggcttcctgggcgaattcgccacggccaataatcccgtctgcgacaaggcgctggaa
ggcatgctcacctatatgcaaaagaacagcgacgtgtggctgggctggacctggtgggcg
gcgggttcctggtggaagccggactacgccttcaccgtgcaaccgggcaaggacggcagc
gacaagccgcagatggcgatcctgagcaagtacgcacgccgtgccggcaagtag

DBGET integrated database retrieval system