KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0261Help
Entry
XOO_0261          CDS       T00360                                 

Definition
transglycosylase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO_0261
Enzymes [BR:xom01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XOO_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285021..287183
Genome map
AA seq 720 aa AA seqDB search
MTLPRRALPLVLGLLPLAACADPAFDRCLAGLQTQAAAKGVDPAGFQRFTAGLVPDPSVL
PLLDAQPEFTTPIWDYLASLVDNQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGV
ESDYGRVTGKRPLLVSLATLSCAGRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFG
QTQFMPSTYTRIAVDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGMEVTLPRGF
DASKAGRTRRQPLQAWQTAGLLGTDGKPLAPIGLPAETPAALLLPAGATGPAFLVFRNYD
AIYAYNAAESYALSIALLADRLRGGPGLIATWPTDDPGLGRPERRELQQLLLARGYQIGE
ADGMVGSATRRAIQVEQIRLGLQPADGRPGQRILTALRAAPPLAGVAAVRATAFKLPTAY
PAFAQSAIVHKASPMSDTTGLTTGDFHGFPSLLIETPFSTAAISLFGGQLVSFVPKGGQD
VMWLSPLAKQPPTPIRGGAPVCWPYFGRQGQIGDVPAHGFVRTVAWRLTESRREDDGTVV
LTLTPPRLDDLALRLRMTLRIGRTLEQRLITENTSAAPVRFTQALHNYFRVGDALKISVQ
GLDGLDYLDKYENYATAHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPVLGRRIVIA
TEGSRSLVAWNPGEEAGKKMADVGDGWRDYVCLEAANAGPDVIELAPGASHTLTQTISVE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgccccggcgcgcattgccgttggtgctgggactgctgccactggccgcctgc
gccgatcccgccttcgaccgctgcctggctggcctgcagacccaggccgctgccaagggc
gtggaccctgcaggctttcagcgtttcaccgccgggctggtgcctgatcccagcgtgttg
ccgctgctggatgcacagcccgaattcaccacgccgatctgggattacctggccagcttg
gtcgataaccagcgcgtgaccgatggccaggccatgctggtcacccaccgcgcgctgttg
actcgcctgtccgaacaaaccggcgtggacccggccaccatcgtggcggtgtggggcgtg
gagagcgactacggccgcgtcaccggcaagcgcccgctgctggtgtcgctggccacgctg
tcgtgtgcaggccgccgccagccgttcttccgtgacgaattcctcgccttgctcagcctg
ctgcaacgaggcgatctggctgcggatgggctgaccggctcctgggccggcgcattcggg
cagacccagttcatgccctcgacctacacccgcatcgcggtggatggcgacggcgacggc
cgccgcgatctggtcgccagcattcccgacgcactggcctcgaccgccaactatctggtc
aaggccggctgggaacgcgcccgcccgtggggcatggaagtcacgctgccgcgcgggttc
gatgccagcaaggccggccgcacccgccgccaaccgctgcaggcctggcaaaccgccggc
ctgctcggcaccgacggcaaaccgctggcaccgatcgggttgccggcggagacccccgcc
gccttgctgctgccggccggcgccaccggcccggcgttcctggtgttccgcaactacgac
gccatttatgcttacaacgccgccgaaagttacgcgctgtccatcgccctgctcgccgac
cgcctgcgcggcggccccggcctgattgccacctggcccaccgacgacccgggcctgggg
cggcccgaacggcgcgaactgcagcagttgctgctcgcccgcggctaccagatcggcgag
gccgacggcatggtcggcagcgccacccgccgtgccatccaggtcgagcagatccgcctg
ggcctgcaaccggccgacggccgtcccggccaacgcatcctcaccgccctgcgcgccgcg
ccgccgctcgccggcgttgcggccgttcgcgccaccgccttcaagctgccgaccgcatac
ccggccttcgcccaatccgccatcgtccataaggcatcccccatgtccgacaccaccggc
ctgaccacaggcgatttccacggctttccatcgctgctgatcgaaacgccgttctccacc
gcggccatcagcctgttcggcgggcaactcgtgtcgttcgtgcccaagggcggccaagac
gtgatgtggctgtcgccgctcgccaagcagccgcccaccccgatccgcggtggtgcgccg
gtgtgctggccgtatttcggtcgccagggccagatcggcgatgtccccgcccacggcttc
gtccgcaccgtggcctggcgactcaccgaaagccgccgcgaagacgacggcaccgtggtg
ctcacgctcaccccgccgcgcttggacgacctggcgttgcgcctgcgcatgacgctgcgc
atcggccgcacgcttgagcaacgcctgatcactgaaaacaccagcgccgccccggtgcgt
ttcacccaggcgctgcacaactatttccgcgtcggcgacgcgctgaagatcagcgtgcag
ggcctggatggcctggactacctcgataaatacgagaactacgctaccgcacaccgtcag
caaggcgactggagcctgcgcgacccacgcgatcccggccgcagcgaccgtatctacacc
aatgccggtggccgctacacgctcaccgacccggtgctcggccgccgcatcgtcatcgcc
accgaaggcagccgctcgctggtggcttggaatccgggcgaagaggccggcaagaagatg
gccgacgtgggcgacggctggcgcgactacgtctgcctggaagcggccaacgccggcccg
gatgtgatcgaactcgcccccggcgccagccacaccctgacccagaccatcagtgtcgag
taa

DBGET integrated database retrieval system