KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0280Help
Entry
XOO_0280          CDS       T00360                                 

Definition
toluene tolerance protein
Orthology
K02066  
phospholipid/cholesterol/gamma-HCH transport system permease protein
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
ABC transporters
Module
Phospholipid transport system
gamma-Hexachlorocyclohexane transport system
Brite
KEGG Orthology (KO) [BR:xom00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    XOO_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(308279..309028)
Genome map
AA seq 249 aa AA seqDB search
MAFVDSIRAFGRAGLFSLTVLRGSLPTRDFIAELVREIYKVGARSLPIIAVGGAFVGLVL
TLQGYRTLTTYGASDALSTLLGLSLYRELAPVLTALLFIGRAGSSIAAELGLMRATDQIK
ALELMAIDPVAKAVAPRFWAAVLTVPLLTGVFCSLAITGGYVEAVHVLGIDNGTFWSGLS
NSVDVWDDFGVAMLKSAIFGGTAALVAAYVGFHAEPTIEGTSVATTRAVVNASLLVLMFN
FVLSAMLFR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgtcgattccatccgcgcctttggccgcgccgggctgttctcgctcacggtg
ctgcgcggttcgctgcccacgcgcgatttcattgccgagctggtgcgcgaaatctacaag
gtcggcgcacgctcgttgccgatcatcgccgtgggcggtgccttcgtcggcctggtgctg
accttgcagggctaccgcacgctcaccacgtacggtgcgtccgatgcgttatccaccttg
ttaggcctgtcgctgtaccgcgaactggcgccagtgctgaccgccttgttgttcatcggc
cgcgccggcagttcgattgcggccgagctcggcttgatgcgcgccaccgaccagatcaag
gcgctggagctgatggccatcgacccggtcgccaaggcggtagcgccgcgcttctgggcg
gcggtgctgacggtgccgctgttgactggcgtgttctgctcgctggccatcaccggtggc
tatgtcgaagcggtgcatgtgctggggatcgacaacggcaccttctggtccgggctgagc
aatagcgtggacgtctgggacgacttcggcgtggcgatgctcaagtcggcgattttcggc
ggtaccgctgcactggttgccgcctacgtgggcttccacgccgaaccgaccatcgaaggc
acttcggtcgccaccacccgcgcggtggtgaatgcctcgttgctggtgctgatgttcaac
ttcgtcctttctgcaatgttgtttaggtga

DBGET integrated database retrieval system