KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0397Help
Entry
XOO_0397          CDS       T00360                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO_0397
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XOO_0397
Enzymes [BR:xom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XOO_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
430148..431071
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLHEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMGASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPETLTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgttcccaccgacatcggcgccggc
caccgcggcgcgcgcatgggaccggaggcgctacgcatcgccggactgcacgaggccctg
gtcggccgcggtgtggaggtgcgcgacctgggcaacctggatggcccgcgcaatccctgg
caggcaccgcaagccggctaccggcatctggacgaagtggtggcctggaaccaggcgctg
atgggcgccagctacgccgaactgcgtgccggacgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctccatcaccgcggtggccaagtactgccgcgagcagggccgg
ccgttgcgggtgctgtggctggatgcgcactcggacttcaacaccagcgaggtgacgccc
tcgggcaatgtgcacggcatgccggtggcctgtctgtgcgggctgggcccggagacgctg
acccatctgggcggcagtgcgccggcgctgttgcccgagcaggtacggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaggccgcgttgcaggacatg
agtgccgacacgcacctgcatgtgagcttcgatgtggacttcctcgaccccagcatcgcg
ccgggcgtgggcaccaccgtgcccggtggccccaactaccgcgaggcgcagctggtgatg
gagatgatcgccgacaccgggcgcatggggtcgttggacatcgtcgagctcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aaatcgacgctgatgcgggattga

DBGET integrated database retrieval system