KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0397Help
Entry
XOO_0397          CDS       T00360                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xom01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xom00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
430148..431071
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLHEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMGASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPETLTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgttcccaccgacatcggcgccggc
caccgcggcgcgcgcatgggaccggaggcgctacgcatcgccggactgcacgaggccctg
gtcggccgcggtgtggaggtgcgcgacctgggcaacctggatggcccgcgcaatccctgg
caggcaccgcaagccggctaccggcatctggacgaagtggtggcctggaaccaggcgctg
atgggcgccagctacgccgaactgcgtgccggacgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctccatcaccgcggtggccaagtactgccgcgagcagggccgg
ccgttgcgggtgctgtggctggatgcgcactcggacttcaacaccagcgaggtgacgccc
tcgggcaatgtgcacggcatgccggtggcctgtctgtgcgggctgggcccggagacgctg
acccatctgggcggcagtgcgccggcgctgttgcccgagcaggtacggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaggccgcgttgcaggacatg
agtgccgacacgcacctgcatgtgagcttcgatgtggacttcctcgaccccagcatcgcg
ccgggcgtgggcaccaccgtgcccggtggccccaactaccgcgaggcgcagctggtgatg
gagatgatcgccgacaccgggcgcatggggtcgttggacatcgtcgagctcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aaatcgacgctgatgcgggattga

DBGET integrated database retrieval system