KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0397Help
Entry
XOO_0397          CDS       T00360                                 

Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO_0397
  Amino acid metabolism
   00220 Arginine biosynthesis
    XOO_0397
   00330 Arginine and proline metabolism
    XOO_0397
Enzymes [BR:xom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XOO_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
430148..431071
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLHEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMGASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPETLTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgttcccaccgacatcggcgccggc
caccgcggcgcgcgcatgggaccggaggcgctacgcatcgccggactgcacgaggccctg
gtcggccgcggtgtggaggtgcgcgacctgggcaacctggatggcccgcgcaatccctgg
caggcaccgcaagccggctaccggcatctggacgaagtggtggcctggaaccaggcgctg
atgggcgccagctacgccgaactgcgtgccggacgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctccatcaccgcggtggccaagtactgccgcgagcagggccgg
ccgttgcgggtgctgtggctggatgcgcactcggacttcaacaccagcgaggtgacgccc
tcgggcaatgtgcacggcatgccggtggcctgtctgtgcgggctgggcccggagacgctg
acccatctgggcggcagtgcgccggcgctgttgcccgagcaggtacggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaggccgcgttgcaggacatg
agtgccgacacgcacctgcatgtgagcttcgatgtggacttcctcgaccccagcatcgcg
ccgggcgtgggcaccaccgtgcccggtggccccaactaccgcgaggcgcagctggtgatg
gagatgatcgccgacaccgggcgcatggggtcgttggacatcgtcgagctcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aaatcgacgctgatgcgggattga

DBGET integrated database retrieval system