KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0593Help
Entry
XOO_0593          CDS       T00360                                 

Definition
methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xom02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xom02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642318..643805
Genome map
AA seq 495 aa AA seqDB search
MHTGVGRQVLHGGLPCFEQSSPIAPELSVANDSAAMTDDEISSTETAPDIATQPPLFVLG
VGAARLDAGRLAELLDAVAGAANLAIMLLLRDRQLLDEAHLRALLGKQATLLSVPFDGEK
LQPGRFYLPPADTVVTLEEGRIRLRALPNGESDHGLIDSFFVSMAHDQDGNVIGLIMGRF
DGDGTLGTAAIKECGGLALAVDDASLHGLDLRSANNPAAITDDILPLPQVAARIAAHMQR
HHGFGHPGPLGLCNGSESDKLSQIAAILRNTTGHDFHGYKRATFLRRVQQRMQVAQVEML
EQYLHILRYRFDEPLQLFNDLLIGVTKFFRDRRGFELLEQQVIPRLFQGKHTDDSMRVWV
LGCSTGEEAYSLAMLLREHAETLDSAPRIQIFASDIDGRALATARVGRYASSIVGEVALE
RLRRWFVKEGDTYVVNKELRELCVFSQHSIVKDPPFSRLDLVSCRNLLIYLDAELQNRVI
PIFHFGIRPGGYLFS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgcatacaggcgttgggagacaagtgctgcatggcggtctgccgtgctttgagcaatca
tcgccgattgcgcctgagctcagcgttgcgaacgatagtgccgccatgaccgacgacgaa
atttccagcaccgagaccgcccctgacatcgccacgcagccgcccttattcgtgctgggc
gtgggcgccgcgcggcttgatgcaggccgcttggcagaattgctcgatgcggtagcaggc
gctgcgaatctggcgatcatgctgctgctgcgcgatcgccagttgctggacgaggcgcac
ctgcgcgcattgcttggtaaacaagccacgctgttgtcggtgcccttcgatggcgagaaa
ttgcagccggggcgcttctatctaccgcctgccgataccgtggtcacgctggaggaaggg
cgtatccgcctgcgggcattgcccaacggcgaaagcgaccacgggttgatcgacagtttc
ttcgtgtcgatggcgcacgatcaggacggcaatgtgatcggtctgatcatggggcgtttc
gacggcgacggcacgctgggcacggcagcgatcaaggaatgcggcggcctggcgctggcc
gtggacgatgcctcgctgcatgggctggatctgcgcagcgcaaataatccggctgccatc
accgacgacatcctgccgctgccacaagtggctgcacgcatcgctgcgcacatgcagcgt
caccacggcttcggtcatccgggaccgctgggcctgtgcaatggcagcgagagcgacaag
ctcagccagattgccgcgatcctgcgcaataccaccggccacgattttcacggttacaaa
cgcgccacgttcctgcgtcgcgtgcagcagcgcatgcaggtcgcgcaggtggaaatgctt
gagcagtatctgcacatcctgcgctaccgcttcgacgagccgttgcagctgttcaacgac
ctgctgattggcgtgaccaagttttttcgcgaccgccgcggattcgaattgctcgagcag
caggtgatcccgcggttgtttcagggcaagcacaccgacgacagcatgcgcgtctgggtg
ctgggttgctccaccggcgaagaagcctattcgctggcgatgctgctgcgcgagcatgcc
gaaaccctggacagcgcgccacgtatccagatcttcgccagcgatatcgacgggcgtgcg
ctggccaccgcgcgggtggggcgctatgcctccagcatcgtgggcgaggttgcgcttgag
cgcttgcggcgctggttcgtcaaggaaggcgacacctatgtggtgaacaaggaactgcgc
gagctgtgcgtgttctcccagcacagtatcgtcaaggatccgccgttttcgcggctggat
ctggtctcgtgccgcaatctgctgatctatctggatgccgaattgcagaatcgggtcatc
ccgatctttcatttcggcatccgcccgggcggctatctgttttcctga

DBGET integrated database retrieval system