KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0656Help
Entry
XOO_0656          CDS       T00360                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO_0656
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO_0656
   00020 Citrate cycle (TCA cycle)
    XOO_0656
   00620 Pyruvate metabolism
    XOO_0656
Enzymes [BR:xom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XOO_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708090..709883
Genome map
AA seq 597 aa AA seqDB search
MAEIKEALVPDIGDYSDVPVIEVLVSVGDTVSKDQSLVTLESDKATMEVPSSVSGVVKEI
KVKLGDSLSQGALVALIEVADAGVDAGAAAAAKPAAAAAAPAAPAKAAPASAPAPAAKAE
AAAPAASSNGGLTEARVPDIGDYTDIPVIEVLVAVGDTVAKDQSLVTLESDKATMEVPSS
AAGVVKELKVKVGDLLSQGSVVAIIAASDGGAGAAQSSVKPTTDTAETAGKVEPVAVPAE
PDKLAQREIAQVQGARSGAAAQSAQVSQPSAGNPSSPPVTFDADSVLPSKVPYASPVVRV
FARELGVDLNQLKGSEKGGRITREDVQRFVKAALSGGAPAAAGAVPAGGANGLNLLAWPK
VDFSKFGETETQPLSRIKKISGANLARNWAMIPHVTQFESADITDLEALRVALNKENEKA
GIKLTMLAFLVKASAAALKTFPEFNASLDAAGENLTLKKYINIGFAADTPNGLVVPVIRD
VDKKGVLQIAQESGELAKKARDGKLGPADMSGGCFSISSLGGIGGTAFTPIINAPEVAIL
GVSKSAMQPVWNGKEFVPKLMLPLSLSYDHRVIDGALAARFTTYLSQVLADMRRVLL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaggaagcacttgtccccgatatcggtgactacagcgacgtcccggta
atcgaggtgctggtgtccgtcggcgatacggtcagcaaggaccagagcctggtcacgctg
gaatcggacaaggccaccatggaagtgccgtcgtcggtgtccggcgtggtcaaggagatc
aaggtgaagctgggtgattcgctctcgcagggcgcgctggtggcattgatcgaagtggcc
gatgccggcgtcgatgccggcgctgctgctgcagccaagcccgcagctgctgctgctgcg
cccgccgcgccggccaaggccgctcctgcgtctgccccggcacccgcggccaaggccgaa
gccgctgcgcctgctgcctcctcgaacggcggcctgaccgaagcgcgcgtgcccgatatc
ggcgattacaccgacatcccggtgatcgaagtgctggtcgctgtcggcgataccgtcgcc
aaggaccagagcctggtcaccctggaatcggacaaggccacgatggaagtgccgtcctcg
gcggccggcgtggtcaaggagctcaaggtcaaggtcggcgacctgctctcgcagggcagt
gtggtggcaatcattgcagccagcgatggcggtgcgggggcggcgcagtcgtccgtcaag
cccaccaccgacaccgccgagacggcgggcaaggtcgagccggtcgccgtgccggccgag
ccggacaagctggcccagcgcgaaattgcgcaggtgcagggcgcccgttccggcgcagct
gcgcagtccgcgcaggtcagccagccgtcggccggcaacccgagcagcccgccggtgacc
ttcgatgccgacagcgtgctgccgtccaaggtgccgtacgccagcccggtggtgcgcgtg
ttcgcacgcgaactgggcgtagacctgaaccagctcaagggcagtgaaaagggcggccgc
atcacccgcgaagacgtgcagcgctttgtgaaggcggcactcagcggcggcgcacctgcc
gccgccggcgctgtgccggccggtggcgccaacggcctgaacctgctggcctggccgaag
gtggacttcagcaagttcggcgagaccgaaacccagccgctgtcgcgcatcaagaagatt
tccggagccaacctggcgcgcaactgggccatgattccgcacgtcacccagttcgagtcg
gccgacatcaccgacctggaagccctgcgcgtggccctcaacaaggaaaacgagaaggcg
ggcatcaagctcaccatgctcgccttcctggtcaaggccagcgccgcggcgttgaagacg
ttccccgagttcaacgcctcgctggatgcggccggcgaaaacctcacgctgaagaagtac
atcaacatcggcttcgcggccgatacaccgaatggcctggtggtgccggtgatccgcgac
gtcgacaagaagggcgtgctgcagatcgcgcaggaaagcggcgaactggccaagaaggcg
cgcgacggcaagctgggtccggccgacatgagcggcggctgcttctcgatcagctcgctc
ggcggcatcggcggtaccgcgttcacgccgatcatcaatgcgccggaagtggcgatcctg
ggcgtgtccaagtcggcgatgcagccggtctggaacggcaaggagttcgtgcccaagctg
atgctgccgttgtcgctgagctacgaccaccgggtcatcgacggcgcgctggcggcccgt
ttcaccacctacctcagccaggtgctggccgacatgcgtcgcgtcctgctgtga

DBGET integrated database retrieval system