KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0722Help
Entry
XOO_0722          CDS       T00360                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    XOO_0722
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOO_0722
Enzymes [BR:xom01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     XOO_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778033..778590
Genome map
AA seq 185 aa AA seqDB search
MKIVETRLPGCVVIEPAVFGDERGYFFETWNAERFGQHGLPTQFLQSNVSTSAKGVLRGL
HYQWPRPQGKLVSVLEGEVYDVAVDVRHGSPNFGQWAAVVLSAENKKQFWIPEGFAHGFA
VLSERAVFSYLCTDVYVKEADAGVRWDDAAIGIDWPISNPLLSAKDAAAPFLADVPAERL
PVYKP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgtcgaaacgcgtttaccaggttgtgtcgtcatcgagccggcagtgttcggc
gatgagcgcggatatttcttcgaaacgtggaatgccgagcgcttcgggcaacatggtctg
ccgacgcagttcttgcagagcaatgtctccacctcggccaaaggcgtgttgcgtggtttg
cattaccagtggccgcgtcctcagggcaagctggtcagcgtgctggagggtgaggtctac
gatgtggcggtcgacgtgcgccacggctcgcccaacttcgggcagtgggcggcagtagtg
ttgagcgcagaaaacaagaagcagttctggataccggaagggtttgcgcacggctttgca
gtgctgtcggagcgagccgtgttcagttacctgtgcaccgacgtgtatgtgaaggaggcc
gatgccggcgtgcgctgggatgatgcggcgatcggtatcgattggccgatcagcaatcca
ttgctctctgcaaaggacgccgctgcgccgtttctggccgatgtgcccgctgagcgcttg
ccggtgtataaaccgtga

DBGET integrated database retrieval system