KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0765Help
Entry
XOO_0765          CDS       T00360                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Brite
Enzymes [BR:xom01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XOO_0765
Secretion system [BR:xom02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XOO_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824337..825134
Genome map
AA seq 265 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASTVGAKPAAAPAAAGNVDQRVSTALKALDPDFKP
DYLGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTV
PKADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQDH
KEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQL
GGYLPPAQLREALEKRAVATAGGSR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcgctgctgggcgcgatcagccttaccgcctgcgcacaa
tcgtcgcagcctgcggcaagcactgtcggcgccaagcccgccgccgcgcccgccgccgcc
ggcaacgtggatcagcgcgtgagcacggcgctcaaggcgctggacccggatttcaagcct
gactacctcggtgctgcaccattccccggcttccgcgaagtggtcgtcggtgggcaggtg
ctgtacgtcagcgatgacggccgttacctgatccaggcgcagccgttcgacatccagaac
aagcaattcgccgccagcccgggcctgctggcctaccgccgcaagcagctggacactgtg
cccaaagccgaccgcatcgtctttgcgccggcaaacccgaagtacaccgtcaccgtcttt
accgacgtggaatgtggctactgccgcaagctgcacagcgagatcggcgagctcaacaag
cagggcatcgcggtggaatacctcgcgttcccgcgcatgggcctgggcagccaggaccac
aaggaaatgatcgcggtgtggtgcgctgccgatcgcaagcaagcgctgacggccgccaag
tccggtcagccggtggcttccaaggactgcaagaacccggtgtcgatggaatacaccctg
ggccagcgcctgggtgtcaacggtacgccggcgatctttgcgccagacggcacgcagctt
ggtggctacctgccgccagcgcagctgcgtgaggcgctggaaaagcgcgccgtcgccacg
gccggcggcagccgctga

DBGET integrated database retrieval system