KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0852Help
Entry
XOO_0852          CDS       T00360                                 

Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Brite
Enzymes [BR:xom01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XOO_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(929888..930544)
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVEIPLSAGY
KMMKPVVEGRMLQALDLQPGEDVLEVGTGSGFATACLATLAREVVSLEIDPALAAAARAN
LDRTGLGSNVRIETADVFCWQSERRFDAICVTGAVDTLPVQWLQWLRPNGRLFVVHGHEP
VMEAVLVRGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggttgagcagcagatccggccgtgg
gacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcctacaagacgctggcctatgtcgacgtggaaattccgctgtcggccggttac
aagatgatgaagccggtcgtcgaaggccgcatgttgcaggcgctggatctgcagccgggc
gaagacgtgctggaagtgggcactggcagcggctttgccaccgcctgcctggccacgctc
gcgcgcgaagtcgtcagcctggagatcgacccggcgctggccgccgccgcacgcgccaat
ctggaccgtaccggcctgggtagcaatgtccgtatcgaaaccgccgacgtattctgctgg
cagagcgaacgtcgcttcgatgccatctgcgtgaccggcgcggtcgataccctgcccgtg
cagtggctgcagtggttgcgcccgaacggccggctgtttgtcgtacacggtcacgaaccg
gtgatggaagcggtcctggtccggggcgacgtcaacgccccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggcgccgcaccgacgccccgattccagttctga

DBGET integrated database retrieval system