KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0878Help
Entry
XOO_0878          CDS       T00360                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO_0878
   01230 Biosynthesis of amino acids
    XOO_0878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO_0878
   00030 Pentose phosphate pathway
    XOO_0878
   00051 Fructose and mannose metabolism
    XOO_0878
   00052 Galactose metabolism
    XOO_0878
  Energy metabolism
   00680 Methane metabolism
    XOO_0878
Enzymes [BR:xom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XOO_0878
Protein phosphatases and associated proteins [BR:xom01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XOO_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(963183..964439)
Genome map
AA seq 418 aa AA seqDB search
MITGNVLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREDLIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAYDQTAFLAKVKQVVDKVGWCVV
VASEGIQNAHGKFVADAGGAADSFGHAQLGGVAAFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDTPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAPLAYGSDGLPTYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcactggcaacgtgttgtatgcccaatccggcggcgttaccgccgtcatcaacgcc
accgccgccggtgtcatcgccgaagcgcgcgcgcgcaagatcaaggtactggctgcacgc
aacggcatcctgggcgcattgcgcgaggacttgatcgacacatccaaagaatccgccgca
gccattgccgcattggcgcagacacccggcggcgcgttcggctcgtgccgctacaagctc
aaatcgttggaagaggacagcgccaagtacgagcgcctgctcgatgtgctgcgcgcgcac
gatgtgcgctggtttctctacaacggcggcaatgattcggccgacaccgcgtggaaggtc
tcgcaactcgcaaaagcctatggctacccactgcactgcatcggcgtacccaagaccatc
gataacgacctggcggtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtccgcgaggccgccttggacgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaagccatgggccgccacgccggctggctggccgcagccgcaggcctt
gccgggcagggccccgacgacgcaccgcagatcatcctgctgcccgaacgcgcctacgac
cagaccgcgtttctggcaaaggtaaagcaggtagtggacaaagtcggctggtgcgtcgtg
gtagccagcgaaggcatccagaacgcgcacggcaagttcgtcgccgatgccggcggcgcg
gcggattccttcggccacgcgcagctcggcggcgtggccgcgttcctggccgcacaggtc
aagcaggaactcggctacaaggtgcactggaccttgcccgattacctgcaacgctccgca
cgccacctcgcatcgaagaccgactgggaacaggcccaagccgtcggcaaggccgccgtg
cagtacgccctcaagggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacacc
ccctaccgctggaagatcgtacccgcgcccctgcacaaggtggccaaccacgaaaagaaa
atgccgcccagtttcctgcgcaaggacggcttcggcatcaccgagcgcgcccgccgctac
ttcgccccgttgatcaaaggcgaagcgccgctggcctacggcagcgatggtttgccgacg
tatgtgacgttgaagaatgtggcggtggcgaagaagttgccggcgtgggaggggtga

DBGET integrated database retrieval system