KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0966Help
Entry
XOO_0966          CDS       T00360                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xom03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055884..1056477
Genome map
AA seq 197 aa AA seqDB search
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLATTLANAVEKVGHCVQCRD
FTESEICTICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFVLQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcactgctagaacaactgatcgaggccttccgggtattgcccggtgtgggccag
aagtcggcgcagcgcatggcgtatcacgtgctcgagcgcgagcgcgagggtgggcggcgt
ctggcgacgacgttggccaatgcggtggaaaaggtggggcattgcgtgcagtgccgcgac
ttcaccgagtccgagatctgcaccatttgcgccagcagcagtcgcgaccggcagcaattg
tgcgtggtcgaatcgccggccgaccgcctggcaatcgagcatgccaccggctaccgcggg
ctgtatttcgtcctgcaggggcgcctgtcgccgctggatggcatcggcccacgcgaactg
ggattggatcggctcggcgagcgtctggccgctggcgaagtgaccgaaatgatcatcgcc
accaacgccaccgtggaaggcgaggcgaccgcccattacctcgcgcagcttgcccgccag
cacgcggtacgcccgagccggcttgcccagggcatgccgctgggcggcgagctggaatac
gtggatcgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctgtga

DBGET integrated database retrieval system