KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_0966Help
Entry
XOO_0966          CDS       T00360                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xom00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XOO_0966 (recR)
DNA repair and recombination proteins [BR:xom03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XOO_0966 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055884..1056477
Genome map
AA seq 197 aa AA seqDB search
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLATTLANAVEKVGHCVQCRD
FTESEICTICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFVLQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcactgctagaacaactgatcgaggccttccgggtattgcccggtgtgggccag
aagtcggcgcagcgcatggcgtatcacgtgctcgagcgcgagcgcgagggtgggcggcgt
ctggcgacgacgttggccaatgcggtggaaaaggtggggcattgcgtgcagtgccgcgac
ttcaccgagtccgagatctgcaccatttgcgccagcagcagtcgcgaccggcagcaattg
tgcgtggtcgaatcgccggccgaccgcctggcaatcgagcatgccaccggctaccgcggg
ctgtatttcgtcctgcaggggcgcctgtcgccgctggatggcatcggcccacgcgaactg
ggattggatcggctcggcgagcgtctggccgctggcgaagtgaccgaaatgatcatcgcc
accaacgccaccgtggaaggcgaggcgaccgcccattacctcgcgcagcttgcccgccag
cacgcggtacgcccgagccggcttgcccagggcatgccgctgggcggcgagctggaatac
gtggatcgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system