KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1212Help
Entry
XOO_1212          CDS       T00360                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xom00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xom00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1320446..1321570
Genome map
AA seq 374 aa AA seqDB search
MCAAAWSAAASCGYARGLPSLAGRSMQRVFGQLTDGVEIHALTLRSEAGLEAEVLTYGGI
LHTLQLTSARGVLPLVLNLPDLPAYAADGDSLNILVGRFGNRIAGARYTLDGVTHVLAAN
EGRNQLHGGLRGFGRRVWSVLEQAPDHVLLGYDSPDGEEGYPGNLQVRARLQLHGLSLQL
DFEAHCDAATALNLTHHPYFNLSGDPHLRAAVQVLRVPADRYLPVDAESIPTGEIASVAG
TPFDFRQPAALADNTDPAHPQVVLGKGYDQCLVLAADADCVAELYSPHSGVALRIRSDAP
AVQLYEGQHLDAHHPGLGRGVCLEPQDYPDAPNHANFPSTILRPGETYRRRISYHFASAG
QDQPWDMVCAALEG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcagcagcatggtcggcagccgcatcgtgcggctatgctcgcgggcttccctca
ttggcaggacgatccatgcagcgagtgttcgggcagttgacagacggtgtcgagattcat
gcgctcacgctacgcagcgaggccggtctcgaggcggaggtgctcacctatggcggcatc
ctgcatacgctgcagttgaccagcgcacggggcgtgctgcccctggtgctgaacttgccg
gatctgcccgcctacgccgccgacggcgacagtctcaatatcctggtgggccgcttcggc
aaccgcatcgccggtgcgcgctacacgctggatggcgttacccacgtgctggcggccaat
gaagggcgcaaccagttgcatggcggtctgcgcggttttgggcgacgcgtgtggagtgtg
ctggagcaggcgccggatcacgtactgctgggctacgactcgcccgatggcgaagaaggt
taccccggcaatctgcaagtgcgtgcgcgcctgcagcttcacgggttgagcctgcagctg
gatttcgaagcgcactgcgacgccgctacggcgttgaaccttacccatcatccatatttc
aatctgtccggcgacccgcacctgcgtgccgcagtgcaagtgctgcgcgtgccggccgat
cgctacctgccggtggatgccgaatcgatcccgaccggcgagatcgcgtcggtggccggc
accccattcgatttccgccagcctgccgcgctcgccgataacaccgatccggcccatccg
caggtggttctcggcaagggctacgatcagtgcttggtgctggccgccgacgcggactgc
gtagccgagttgtattcgccgcacagtggcgtggcgctacgcatccgcagcgatgccccc
gcggtgcagttgtacgaaggccaacatctggacgcacatcatccgggactggggcgcggc
gtatgcctggagccgcaggactacccggacgcgcccaatcacgccaacttcccttcgacg
atcttgcggcctggggaaacctaccgccgccgcatcagctaccacttcgccagtgcgggg
caggaccagccctgggacatggtgtgcgccgcactggaggggtga

DBGET integrated database retrieval system