KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1362Help
Entry
XOO_1362          CDS       T00360                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO_1362 (gpmA)
   01230 Biosynthesis of amino acids
    XOO_1362 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO_1362 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XOO_1362 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOO_1362 (gpmA)
Enzymes [BR:xom01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XOO_1362 (gpmA)
Exosome [BR:xom04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XOO_1362 (gpmA)
  Exosomal proteins of melanoma cells
   XOO_1362 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1485003..1485752
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGKLMKDEGLQFDVAHTSVLK
RAIHTLQGALKELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVDDPGHPCHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDVSNEQILELNIPTGIPLLFELDDNLQVRSFRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaatctggacaaccgt
ttcaccggctgggtggatgtggaactcaccgaccagggccgccaggaagctgtggcggcc
ggcaagctgatgaaggacgaagggctgcagttcgatgtcgcccacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcgttgaaggaactcgaccaggactggttgccggtg
tccaagagctggcgcctcaacgagcgccactacggcggcctgcaaggcctggacaaggcc
gaaaccgcggccaagcacggcgaggagcaggtcaagatctggcgccgttcgtacgacatc
ccgccgccggcgatggacgtcgacgacccggggcacccgtgtcacgaccgtcgctacgcc
acgctcgatcgcaatgcgttgccgggcaccgagtcgctggcgaccacgctggtgcgcgtg
ttgccgtattggcacgacgcgattgcgccgcagttgaaggccgggcagaccgtgctggtg
accgcgcacggcaactcgctgcgtgcgctatacaagtacctcaacgatgtctccaacgaa
cagattctggagctcaatatccccaccggcatcccgctgttgttcgagctggacgacaat
ctgcaggtgcgcagcttccgttatctgggcgatccggaagcggccaagcgtgcggccgag
gcagtagccaaccagggcaaggcgaagtaa

DBGET integrated database retrieval system