KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1366Help
Entry
XOO_1366          CDS       T00360                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xom00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOO_1366
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XOO_1366
Enzymes [BR:xom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XOO_1366
Two-component system [BR:xom02022]
 CheA family
  CheA-CheYBV
   XOO_1366
Bacterial motility proteins [BR:xom02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XOO_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1490699..1491820)
Genome map
AA seq 373 aa AA seqDB search
MSTALNHPSASPTASPNTIKALVVDDSAVVRQVLVNVLNDAADIEVIATAADPLLAIEKM
RKQWPDVIVLDVEMPRMDGITFLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVV
TKPRLGLKQFLTESADELVATVRSAARANVKRLAARVTAAPLEAEVKHTADVILPAQSGR
AMAQTTERIVAIGTSTGGTQALEEVLTALPRVCPGIVIVQHMPEKFTAAFAARLNGLCQI
AVKEAANNDRVMPGRALIAPGGKHLLLRRSGAQYFVEVLEGPPVNRHRPSVDVLFRSAAR
AAGSNALGIIMTGMGDDGAAGLLEMRQAGARTVAQDEQTSIVFGMPKEAIKRGGADRILA
LGAMAREIVTQLQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacagcgctcaaccacccctctgccagcccgaccgccagccccaacaccatcaag
gccctggtggtcgacgattcggcggtggtgcgccaggtactggtgaacgtgctcaacgac
gcggccgatatcgaggtgatcgccaccgcagccgacccgttgcttgcgatcgagaagatg
cgcaagcagtggccggacgtgatcgtgctggatgtggaaatgccgcgcatggacggcatc
acctttctgcgcaagatcatgagcgagcggcccacgccggtggtgatctgctccacgctc
accgaaaaaggcgcccgcgtcaccatggatgcactggccgccggcgcggtggcggtggtg
accaaaccccgcctgggtctgaagcaatttctcaccgaatctgccgacgaactggtggcg
accgtgcgcagcgcagcgcgcgccaacgtcaagcggctggccgcgcgcgtgactgcagcg
ccgctggaagcggaggtcaagcacaccgccgatgtcatcctgccggcacaaagcggacgt
gcgatggcgcagaccaccgaacgcatcgtcgccatcggcacctccaccggcggcacccag
gccctggaagaagtgctcaccgcgctgccgcgcgtctgccccggcatcgtgatcgtgcag
cacatgccggaaaaattcaccgctgccttcgccgcgcgcctgaacggtctttgccagatc
gccgtcaaggaggccgccaacaacgaccgtgtgatgccgggccgtgcattgatcgcaccg
ggcggcaaacatctgctgctgcgtcgtagcggcgcgcagtatttcgtcgaagtgctggaa
ggcccaccggtcaaccggcatcggccctcggtcgatgtgctgttccgctcggccgcgcgc
gcggccggcagcaatgcgctaggcatcatcatgaccggcatgggcgacgatggcgccgcc
ggcctgctggaaatgcgccaggccggcgcacgcacggtggcgcaggacgaacagaccagc
atcgtgttcggcatgcccaaagaagcgatcaagcgcggcggcgcagaccgtatcctggcg
ctgggcgcgatggcgcgcgagatcgtgacgcagctgcaataa

DBGET integrated database retrieval system