KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1670Help
Entry
XOO_1670          CDS       T00360                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xom00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1826254..1828095)
Genome map
AA seq 613 aa AA seqDB search
MLRTTLAPLVLALAFALPVTAAAADTERWPDFGTQGTQFVRDGKPYQLLSGAIHFQRIPR
AYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNNDVAAFVQEAAAQGLNVILRP
GPYACAEWEAGGYPAWLFGQGNIRVRSRDPRFLAASQAYLDAVAKQVQPLLNHNGGPIIA
VQVENEYGSYADDHAYMADNRAMYVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPG
EAKSAFDKLIAFRPDQPRMVGEYWAGWFDHWGKPHAATDATQQAEEFEWILRQGHSANLY
MFIGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAIVDEAGRPTAKFALMRDAIARVTGV
QPPALPAPIATTTLPDTPLRESASLWDNLPAPIAIDTPQPMEHFGQDYGYILYRTTVTGP
RKGPLYLGDVRDVAHVYLDQTPVGSVERRLQQVSTAVDIPAGHHTLDVLVENSGRINYGP
RMADGRAGLVDPVLLGNQQVTGWQAFPLPMRAPDSIRGWTRKAVQGPAFHRGTVRIGTPA
DTYLDMRAFGKGFAWANGVNLGRHWNIGPQTALYFPAPFQRKGDNTVVVFDLDDVATPSV
RGLKQQVWRKPKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaccacccttgcaccgctcgttctggcgctcgccttcgcgctgcctgtcact
gctgcagccgcagacaccgagcgctggccggacttcggcacgcaaggcacacagttcgtg
cgcgacggcaagccgtatcaattgctttccggcgccatccatttccagcgcattccgcgc
gcctactggaaagaccgcctgcaaaaagcgcgtgcgctgggcttgaacacggtggaaacc
tacgtgttctggaatctggtggaaccgcagcaaggccagttcgatttttccggcaacaac
gacgtggccgcgttcgtgcaagaagctgccgcgcaggggttgaatgtcatcctgcggccc
ggcccttacgcctgcgcagagtgggaagccggcgggtatccggcctggttgttcggccag
ggcaacattcgcgtgcgcagccgcgacccacgctttcttgctgccagccaggcctatctg
gatgcggtggccaaacaggtgcagccgctgctcaaccacaacggcgggccgatcatcgcc
gtgcaggtcgagaacgaatacggctcttacgcagacgaccacgcctacatggccgacaac
cgcgccatgtacgtcaaggccggcttcgacaaggccttgctgttcacctccgatggcgcc
gacatgctcgccaacggcaccttgcccgacaccttggcggtggtgaacttcgcacccggc
gaagccaagagcgcattcgacaagctgatcgcgttccgccccgatcaaccgcgcatggtc
ggcgaatactgggcgggctggttcgaccattggggcaagccgcacgcggccaccgatgcc
acacaacaggccgaggagttcgagtggatcctgcgccagggccactccgccaatctctac
atgttcatcggcggcaccagttttggcttcatgaacggcgccaatttccagaacaatccc
agcgatcattacgcaccgcagaccaccagctacgactacgacgccattgtcgacgaagcc
gggcgccccacagccaagttcgcgttgatgcgcgatgccatcgcccgcgtcaccggtgtg
cagccgcctgcattgccggcaccgatcgcgaccaccacgctgccagacacgccgttgcgc
gaatcggcctcgctgtgggacaacctgcccgcaccgatcgccatcgacaccccgcagccg
atggaacacttcggccaggattacggctacatcctttatcgcaccaccgtcaccggcccg
cgcaagggcccgctgtatctgggcgacgtgcgcgatgtggcgcacgtgtatctggatcag
acgccggtcggcagcgtcgaacgccggctgcagcaggtctccaccgctgtggatattccg
gccggccaccacacgctggatgtgctggtggaaaacagcggccgcatcaattacggcccg
cgcatggccgacggccgcgccggcctggtcgacccggtgctgctgggcaaccagcaagtc
accggctggcaggccttcccgctgccgatgcgcgcacccgacagcatccgcggctggacc
cgcaaggcagtgcaaggcccggcgttccaccgcggcaccgtgcgcatcggcacacccgcc
gacacctacctggacatgcgcgccttcggcaagggcttcgcctgggccaacggcgtcaac
ctcggccgccactggaacatcggcccacaaaccgcgctgtatttcccagcgccgttccag
cgcaagggtgacaacacggtggtggtcttcgacctagacgatgtcgccacacccagcgtg
cgcggcctgaagcagcaggtgtggcgcaagccgaaagagtga

DBGET integrated database retrieval system