KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1684Help
Entry
XOO_1684          CDS       T00360                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xom00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xom00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1848420..1850867)
Genome map
AA seq 815 aa AA seqDB search
MSNSAPTARPTAGAPLSSRLLALVFAATSLAGCGQRVPGTPPAAATEGAPAAAAANTART
PLPLIPAAVEVKRGSGSFVVGTGTVISIVPGDADARRSAEHLADLLLRTRGLRLEVRAET
SASPGSIRLERSAQAPVAHKEGYSLEVDAKGVRIAARDGAGLLYGAVSAWQLMTPDTHKG
EVQLPSVAIHDWPRFSWRGQHLDVARHFHDVDTVKHVLDTMALHKLNVLHWHLTDDQGWR
IEIKRYPKLTEVGAWRTPPGAGMDGIPQRYGGFYTQEQISEIVAYAARLHITVLPEIDMP
GHAQAAVAAYPEEVGVPGVRTQVGVDWGVNPYLFNTSERSLTFITNVLDEVLTLFPSTYI
HIGGDEAVKDQWEASPAVRAQMRKLGVKDAHAMQGWFNEQLAAYLTQHGRRMIGWDEILE
GGVPASASVMSWRGVEGAVTAAKQGHDVVLAPGDWLYLDNLQTTRNDEPNGRLTVLPLSK
VYAFDPVPAGLSAEQARHVLGAQGALWSEYISSRWHVDHALFPRLSAVAEVTWSPKAARN
WNSFLARMPAQLQRYKALGIDYSDGAFAADIALENGPNPVLAGGPAKVALSTQTGAGTLH
YTIDGSDPTPASPRYNAPFTIQLPTTVKATAFDANGTPLAATRSRTFDRAGLLRVDTQGL
QHCVETGALGLRLPLLPEMTAADTPVYNVDLFHACRMYPQARLDGIGAIRIDAARLPNNF
GLAHEQSKVVQYPANTRGGELEVRQGCDGELIASVQLPRSDTLGEQFTLETALPARTGIH
DLCLRFTAPIRGPLYAIGAVQLIETTAQAPPAATR
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactccgcacccaccgcacgcccgacagcaggcgcgccgttgtcctcgcgcctg
cttgcgctcgtgttcgcagcaacgtcgctggccggttgcggtcaacgtgtacctggcact
ccaccagccgccgccacggagggcgcacctgccgctgcagcggcaaacaccgcgcgtaca
ccgttgccactgattcctgcagccgtcgaggtcaaacgcggtagtggcagcttcgtcgtg
ggcaccggtacggtgatctcgatcgtgcctggcgatgccgatgcacgtcgcagtgccgaa
catctggccgatctgctgctgcgcacacgcgggctgcgattggaagtgcgcgccgaaacc
agcgcatcgccgggcagcatccgcctggagcgcagcgcgcaggcgccggtagcgcacaag
gaaggctacagcctggaggtggatgccaagggcgtgcgcatcgccgcgcgcgatggagcc
ggcttgttgtatggcgcagtcagcgcctggcaattgatgacaccggatacgcacaagggc
gaggtccagctgccgtcggtggcgatccacgactggccgcgtttcagctggcgcggccag
catctggatgtggcccggcattttcatgatgtggacacggtcaagcatgtgctcgatacg
atggccctgcacaagctcaacgtgctgcattggcatctcaccgatgaccagggctggcgc
atcgagatcaagcgctatcccaagctcacggaggtcggtgcctggcgcacgccgccgggc
gcgggaatggacggcataccgcagcgttatggcggcttctacacgcaggaacagatcagc
gagatcgtcgcttacgccgcgcgcctgcacatcaccgtgctgccggagatcgacatgccc
gggcatgcacaggcggccgttgccgcctatcccgaagaggtgggcgtccccggtgtgcgc
acccaggtgggcgtggactggggcgtcaacccgtacctgttcaacaccagcgaacgcagc
ctgaccttcatcaccaatgtgctggatgaagtgctgaccttgttcccctcgacctacatc
cacatcggtggcgatgaggcggtcaaggatcaatgggaagcctcgccggcggtgcgcgca
cagatgcgcaagctcggagtcaaggacgcgcatgcgatgcagggctggttcaacgaacag
ctggcggcctatctcacccagcacggccggcgcatgatcggctgggatgaaatcctggaa
ggcggcgtgccggcgagtgcgtcggtgatgtcgtggcgcggcgtcgaaggtgcggtcact
gcggccaagcaaggccacgacgtggtgcttgcgccgggcgactggctgtatctggacaat
ctgcaaaccacgcgcaacgacgaaccgaacggtcgcctgaccgtgttgccgctgtcgaag
gtctatgcattcgacccggtgccggccgggctcagcgccgaacaggccaggcatgtgctg
ggcgcacaaggcgcgttgtggtccgaatacatttcctcgcgctggcatgtagatcacgcg
ctgtttccgcggctgtctgcggtggcagaagtgacctggtcgcccaaggcggcacgcaac
tggaacagcttcctggcgcgtatgccggcacagctgcagcgctacaaggcgctgggcatc
gactacagcgacggcgcattcgctgccgatatcgcgctggaaaacggacccaacccagtg
ctcgccggcggcccggccaaggtggcgctgagcacgcagactggggcgggcacgctgcac
tacaccatcgatggcagcgatcccacaccggcatcgccacgctacaacgcaccgtttacg
attcaattgccgaccacggtcaaggccacggcgttcgatgccaacggcacgccgctggcg
gccacgcgaagccgcaccttcgatcgcgccggcttgttgcgcgtagacacgcaaggcttg
caacactgcgtcgaaaccggcgcactcggcttgcgtctgccgctattgccggagatgacc
gccgccgacacgccggtgtacaacgtcgatctgttccatgcctgccgcatgtatccgcag
gcgcggctggacggcatcggcgccatccgcatcgacgccgcacgcctgcccaataacttc
ggcctggcgcatgagcaatccaaggtcgtgcagtacccggccaacacccgcggcggtgag
ctggaagtgcgtcagggctgcgatggcgaattgatcgccagcgtgcagctgccgcgcagc
gacaccctgggtgagcaattcacgctggaaaccgcactgcctgcacgcaccggcatccac
gatctctgcctgcgctttaccgcgccgattcgtggcccgttgtatgccatcggcgccgtt
caactgattgaaaccaccgcgcaggcgccccccgccgccacgcgctga

DBGET integrated database retrieval system