KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1692Help
Entry
XOO_1692          CDS       T00360                                 

Definition
sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XOO_1692
Enzymes [BR:xom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     XOO_1692
Transfer RNA biogenesis [BR:xom03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    XOO_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861677..1862477
Genome map
AA seq 266 aa AA seqDB search
MIRIPMELRETVIAIACDAGAAIMEVYAQDFAVELKDDASPLTQADLAAHRVIVEGLRRV
TPDVPVLSEESAHVAWEERQYWTSYWLVDPLDGTREFVKRNGEFSVNIALIHMGAPVLGV
VQAPVDGRVWYAARGENAFRRDGDRDEMLHTRTPAAKPLRVAASRSHRDARTTAALDRMG
EIDVVAQGSSLKFCRIAEGNLDVYPRFGPTSEWDTAAGQCVLHAAGGVLLACTSGKPFRY
NRRDTLLNGDFIALGDPNLPWRNWLA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcattccgatggagctgcgcgaaaccgtgattgccatcgcgtgcgatgccggc
gccgccatcatggaggtctatgcgcaggacttcgcggtggagctcaaggacgacgccagc
ccgctgacccaggccgacctggccgctcaccgcgtcatcgtcgaaggtctgcgccgggtg
actccagacgtaccggtgttgtcggaagaatccgcgcacgtggcctgggaagaacgccag
tactggaccagttactggctggtcgatccgctcgatggcacccgcgagttcgtcaagcgc
aacggcgagttcagcgtcaatatcgcactcatccatatgggcgcgccggtgctcggggtg
gtgcaggcgccggtcgacgggcgtgtctggtatgccgcacgcggcgagaacgcgttccgc
cgcgatggcgaccgcgacgagatgctgcacacgcgcaccccggcggccaagccgttacgg
gtggccgccagccgttcgcaccgcgacgcgcgtactaccgccgcgctggatcgcatgggc
gagatcgacgtggttgcgcaagggtcgtcgttgaagttctgccgcatcgccgaaggcaac
ctggacgtgtatccgcgcttcggccccacctccgagtgggataccgccgccggccagtgc
gtgctgcatgcggccggtggcgtattgctggcctgcaccagcggcaaaccgtttcgctat
aaccgccgcgacaccttgctcaatggcgacttcattgcgctgggcgaccctaatctgccc
tggcgaaattggttggcctga

DBGET integrated database retrieval system