KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1692Help
Entry
XOO_1692          CDS       T00360                                 

Definition
sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xom00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861677..1862477
Genome map
AA seq 266 aa AA seqDB search
MIRIPMELRETVIAIACDAGAAIMEVYAQDFAVELKDDASPLTQADLAAHRVIVEGLRRV
TPDVPVLSEESAHVAWEERQYWTSYWLVDPLDGTREFVKRNGEFSVNIALIHMGAPVLGV
VQAPVDGRVWYAARGENAFRRDGDRDEMLHTRTPAAKPLRVAASRSHRDARTTAALDRMG
EIDVVAQGSSLKFCRIAEGNLDVYPRFGPTSEWDTAAGQCVLHAAGGVLLACTSGKPFRY
NRRDTLLNGDFIALGDPNLPWRNWLA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcattccgatggagctgcgcgaaaccgtgattgccatcgcgtgcgatgccggc
gccgccatcatggaggtctatgcgcaggacttcgcggtggagctcaaggacgacgccagc
ccgctgacccaggccgacctggccgctcaccgcgtcatcgtcgaaggtctgcgccgggtg
actccagacgtaccggtgttgtcggaagaatccgcgcacgtggcctgggaagaacgccag
tactggaccagttactggctggtcgatccgctcgatggcacccgcgagttcgtcaagcgc
aacggcgagttcagcgtcaatatcgcactcatccatatgggcgcgccggtgctcggggtg
gtgcaggcgccggtcgacgggcgtgtctggtatgccgcacgcggcgagaacgcgttccgc
cgcgatggcgaccgcgacgagatgctgcacacgcgcaccccggcggccaagccgttacgg
gtggccgccagccgttcgcaccgcgacgcgcgtactaccgccgcgctggatcgcatgggc
gagatcgacgtggttgcgcaagggtcgtcgttgaagttctgccgcatcgccgaaggcaac
ctggacgtgtatccgcgcttcggccccacctccgagtgggataccgccgccggccagtgc
gtgctgcatgcggccggtggcgtattgctggcctgcaccagcggcaaaccgtttcgctat
aaccgccgcgacaccttgctcaatggcgacttcattgcgctgggcgaccctaatctgccc
tggcgaaattggttggcctga

DBGET integrated database retrieval system