KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1762Help
Entry
XOO_1762          CDS       T00360                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xom00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:xom00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947752..1948756
Genome map
AA seq 334 aa AA seqDB search
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFGSRSQVVELSAAIRAAAPRPVLICVD
QEGGRVQRFREGFSALAPLQSFGAQYAQAPEAALAAARAHAQLMASEVRASGVDLSFAPV
VDLGRGNRAIGDRAFSDDPQIVATFTRAYVQALHGAGMAATLKHFPGHGTVLEDTHVDHA
SDPRPLEALQAEDLVPFVAGIEAGADAVMMAHVVYPQVAPEPAGYSQRWIEQILRGQMGF
RGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCDVVLVCHPELVAESLQAVQGRRLNTAAL
IGLIGRGALGWDGLLAGTDVSFTTPHSAHFGTTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgatcggcgttgccggtaccgaactcagcgcacaggaacgcgactggctgcag
cacgatgcggttgccggcgtggtgctgttcaagcgtaacttcggctcgcgcagccaggtg
gtcgagctgtcggcggcgatccgcgcggcagcgccgcgcccggtgctgatctgcgtggac
caggaaggcggacgcgtgcagcggtttcgcgaaggattcagcgcgctggcgccgttgcaa
agtttcggggcgcagtacgcgcaggcccctgaggctgcattggcggccgcacgcgcacat
gcgcagctgatggccagcgaggtccgcgccagtggtgtggacctgagcttcgcgccggtg
gtggatctaggccgcggcaatcgcgccatcggcgatcgcgccttcagcgacgacccgcag
atcgtggccaccttcacccgcgcttatgtgcaggcgctgcacggcgccggcatggccgcc
acgctcaaacattttcccggccacggcactgtgctggaagacacccatgtcgaccacgcc
agcgacccgcggccgctggaggcgttgcaggccgaagatctggtgccgttcgtggccggc
atcgaggccggtgccgacgcggtgatgatggcgcacgtggtttacccccaggtggccccg
gaaccggctgggtattcgcagcgctggatcgaacagatcctgcgcggccagatgggcttc
cgcggcgtggtcttttccgacgatatcggcatggccgcctcgttcagtgccggcggcgtg
gcaggccgggtgcatgcgcatctggatgccggctgcgatgtggtgttggtctgccacccg
gaactggtcgccgaatcgctgcaggccgtgcagggccgtcgcctcaataccgccgcattg
atcggcctgatcggccgcggcgcattgggctgggatggcctgctcgccggcaccgacgtc
tcattcaccactcctcattctgcccatttcggaacaactgcctga

DBGET integrated database retrieval system