KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1762Help
Entry
XOO_1762          CDS       T00360                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XOO_1762
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    XOO_1762
Enzymes [BR:xom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XOO_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947752..1948756
Genome map
AA seq 334 aa AA seqDB search
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFGSRSQVVELSAAIRAAAPRPVLICVD
QEGGRVQRFREGFSALAPLQSFGAQYAQAPEAALAAARAHAQLMASEVRASGVDLSFAPV
VDLGRGNRAIGDRAFSDDPQIVATFTRAYVQALHGAGMAATLKHFPGHGTVLEDTHVDHA
SDPRPLEALQAEDLVPFVAGIEAGADAVMMAHVVYPQVAPEPAGYSQRWIEQILRGQMGF
RGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCDVVLVCHPELVAESLQAVQGRRLNTAAL
IGLIGRGALGWDGLLAGTDVSFTTPHSAHFGTTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgatcggcgttgccggtaccgaactcagcgcacaggaacgcgactggctgcag
cacgatgcggttgccggcgtggtgctgttcaagcgtaacttcggctcgcgcagccaggtg
gtcgagctgtcggcggcgatccgcgcggcagcgccgcgcccggtgctgatctgcgtggac
caggaaggcggacgcgtgcagcggtttcgcgaaggattcagcgcgctggcgccgttgcaa
agtttcggggcgcagtacgcgcaggcccctgaggctgcattggcggccgcacgcgcacat
gcgcagctgatggccagcgaggtccgcgccagtggtgtggacctgagcttcgcgccggtg
gtggatctaggccgcggcaatcgcgccatcggcgatcgcgccttcagcgacgacccgcag
atcgtggccaccttcacccgcgcttatgtgcaggcgctgcacggcgccggcatggccgcc
acgctcaaacattttcccggccacggcactgtgctggaagacacccatgtcgaccacgcc
agcgacccgcggccgctggaggcgttgcaggccgaagatctggtgccgttcgtggccggc
atcgaggccggtgccgacgcggtgatgatggcgcacgtggtttacccccaggtggccccg
gaaccggctgggtattcgcagcgctggatcgaacagatcctgcgcggccagatgggcttc
cgcggcgtggtcttttccgacgatatcggcatggccgcctcgttcagtgccggcggcgtg
gcaggccgggtgcatgcgcatctggatgccggctgcgatgtggtgttggtctgccacccg
gaactggtcgccgaatcgctgcaggccgtgcagggccgtcgcctcaataccgccgcattg
atcggcctgatcggccgcggcgcattgggctgggatggcctgctcgccggcaccgacgtc
tcattcaccactcctcattctgcccatttcggaacaactgcctga

DBGET integrated database retrieval system