KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_1881Help
Entry
XOO_1881          CDS       T00360                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xom00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072863..2074557
Genome map
AA seq 564 aa AA seqDB search
MCSIFGIFGLQPGDDLQALRRQALECSQRQRHRGPDWSGVYVDAGAILVHERLAIVDPAG
GSQPLLSEDGQLALAVNGEIYNHRELKAELLQPYAFQTGSDCEVINALYREDVPALYLNR
LNGIFAFALWDKTEGRVIIARDPIGVVPLYWGHDREGRLRVASELKSLVDDCADAAQFPP
GHWYDSATGALSRYYERAWREYAEVEGVQVQLQELREAFERAVHRQLMTDVPYGVLLSGG
LDSSLVAAVAARYARHRVEENDTTEAWWPRLHSFAIGLKGSPDLAAAEVAAAALGTVHHG
FEYTFEEGLDALPDVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFGG
YLYFHKAPNAREFHEELVRKLDALNNYDCLRANKSMMAWGVEPRVPFLDREFLDVAMRMD
ASFKMIDKTSSGAARMEKGVLREAFAGYLPESILWRQKEQFSDGVGYGWIDGLKAHAAAN
VSERELAAADRRYPVNPPQTKEAYFYRTLFEQFFPGQSAAETVPGGKSIACSSPTAIAWD
ASFAAMADPSGRAIAGVHAQAMDS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtgttccatctttggtattttcggcctgcaacccggtgacgacttgcaggcgctacgc
cggcaggcactggaatgttcgcagcggcagcgccatcgcgggccggactggagcggcgtc
tacgtcgatgccggggccatcctggtgcacgagcgcctggccatcgtcgacccggccggc
ggctcgcagccgttgctgtccgaagacgggcagctggcgctggcggtcaatggcgagatc
tacaaccatcgcgaactcaaggccgaactgctgcagccgtacgccttccagaccggctcc
gattgcgaggtgatcaatgcgctgtatcgcgaagatgtgccggccttgtatctcaatcgc
ctcaacggcatctttgcgtttgcgctgtgggataagacggaaggacgggtgatcatcgca
cgcgacccgatcggtgtggtgccgctgtactgggggcacgaccgcgaaggccgtctgcgg
gtggcgtcggaattgaaatcgctggtggacgattgcgccgatgcggcgcagttccctccg
ggccattggtacgacagcgccaccggcgcgctgagccgttattacgagcgcgcctggcgc
gaatatgccgaggtggaaggtgtgcaggtgcaactgcaggaattgcgcgaagccttcgag
cgtgcggtgcatcgtcaactgatgaccgacgtgccgtacggcgtgttgttgtcgggcggg
ctggattcctcgttggttgcagcagttgccgcgcgctacgcccgtcaccgcgtcgaagag
aacgataccaccgaagcgtggtggccacgcctgcattccttcgcgattggcttgaagggc
tcgcccgatttggcagcagcggaagtggccgccgctgcgctgggcaccgtgcaccacggc
ttcgaatacaccttcgaagaggggctggatgcgttgcctgacgtcattcgccacatcgaa
acctacgacgtcaccaccattcgcgcttccacaccgatgttcttattggcgcggcgtatc
aaggcgatgggcgtcaagatggtgctctccggcgaaggcagcgacgagatcttcggcggc
tacctgtatttccataaggcaccgaacgcgcgcgaattccatgaagagctggtgcgcaag
ctcgacgcgctcaacaactacgattgcctgcgcgcgaacaagtcgatgatggcctggggc
gtggagccgcgcgtgccgttcctggatcgcgagttcctcgatgtggcgatgcgcatggac
gccagtttcaaaatgatcgacaagaccagcagcggcgcggcgcgcatggaaaaaggcgtg
ctgcgcgaagcattcgcaggctatctgcccgagtcgattctgtggcgtcagaaggagcag
ttcagcgacggcgtgggctatggctggatcgacgggctgaaggcgcatgccgcagcgaac
gtcagcgaacgcgagctcgccgctgccgaccgacgctacccggtcaacccgccgcagacc
aaggaagcgtatttctatcgcaccttgttcgagcagtttttccccggacagtcggctgcg
gaaaccgtgccgggaggcaagtcgatcgcgtgctcgtcgccaaccgcgatcgcctgggat
gcgagttttgccgcgatggcagacccatcgggccgcgccattgccggcgtccacgcgcag
gcaatggactcgtaa

DBGET integrated database retrieval system