KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2056Help
Entry
XOO_2056          CDS       T00360                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XOO_2056
   00052 Galactose metabolism
    XOO_2056
   00500 Starch and sucrose metabolism
    XOO_2056
   00520 Amino sugar and nucleotide sugar metabolism
    XOO_2056
Enzymes [BR:xom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XOO_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2274982..2275875
Genome map
AA seq 297 aa AA seqDB search
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMADVAEASGGSVIAVEDVPQEKTASYGIVSTDA
FDGRKGRITAIVEKPKPEVAPSNLAVVGRYVLSPKIFEFLEATGAGAGGEIQLTDAIAEL
LKKEQVDAFRFQGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILRNALAQADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtattcgcaaggcagtatttcccgtcgcaggtcttggaacccgctttctt
ccggcaaccaagacggtgccgaaagaaatgctgccaatcatcgacaagcccttgattcag
tacgccgtcgacgaagccatccaggctggttgcgatacgttgatctttgtgaccaaccgc
tacaaacactccattgccgattacttcgacaaggcctacgagctggagcaaaagcttgag
cgtgcaggcaagttggagcagctggagctagtacgccatgcgttgccggaaggcgttcgc
gccatttttgtgacgcaggcagaagcgctcggcctaggccacgcggtgttgtgtgccaag
gccgtggtcggtgacgaaccgttcgcggtgctgctgccggacgatctgatgtggaaccgc
ggcgatgccgcgctgacccagatggccgatgttgcagaggcctccggcggcagcgtcatt
gcggtggaagatgtgccgcaggaaaagacggccagctacggcatcgtctctaccgatgca
ttcgatggccgcaagggccgcatcactgcgatcgtcgagaagcccaagccggaagtggcg
ccgagtaatctggccgtagtcggtcggtatgtgctgagcccgaagatcttcgaatttctc
gaggctaccggtgcaggcgcgggcggcgagatccagctgaccgacgcgattgccgagctg
ctgaagaaagagcaggtcgatgccttccgtttccaaggtcgccgtttcgattgcggtgcg
catatcggcctgatcgaagccaccgtgcatttcgcgctcgagcacgaaaagcatggcggc
ccagcgaaggaaatcctgcgcaacgcattggcccaggccgacgcgcgcggctga

DBGET integrated database retrieval system