KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2111Help
Entry
XOO_2111          CDS       T00360                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO_2111
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOO_2111
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XOO_2111
Enzymes [BR:xom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XOO_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2337690..2338994
Genome map
AA seq 434 aa AA seqDB search
MFISTRGGAPAASLSQAIAAGLAPDGGLYVPQTLPPARTLIAGAGLADTATALLQPFFEG
DALAAELSAICAEAFDFPAPLVALGTPGDYALELFHGPTAAFKDFGARFLAACLTRLRRA
EDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGSFDDCQAMVKQALNDAALQTQVPLSSANSISLGRLLPQMSYYAHAALQHHAAWGDVLN
LVVPTGNLGNALAAIIARALGVPLGRIALASNANHVLPDYFAGDAYAPQPSVATLANAMD
VGAPSNFERLRWLYNGDDAALREEFRALSVDDAAIRHTVQQRFARYGEVHCPHTATAVHV
LEQLRAEGAEGGTGDWAVAATAHPAKFEGVVEPLIGRTVEVPPALAALLQRPAQAEALAA
DYAAFRQRLLADAT
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttcatctccacccgtggcggtgcccccgccgcaagcctgagccaggccattgccgcc
gggctggcgcccgatggcggcctctacgtgccacagaccctgccacctgcccgtacgctg
attgcgggcgccggccttgccgacaccgccactgcgctattgcagccatttttcgagggc
gatgcactggcggcagaactctctgccatctgtgccgaggccttcgatttcccggcgcca
ttggtggccttgggtacgccgggcgattacgcgctggagctgtttcatggccccaccgcc
gcattcaaggatttcggtgcgcgtttcctggcggcctgcctgacccgcctgcgccgtgcc
gaagaccgcccgctcaccatcctggtcgccacctccggcgacaccggtgccgccgtggcc
gctgcgttccatcggcagcctggcctgcgtgtggtggtgctctacccggacggccgcgtg
tcgccacgccaggcgcatcagctggggtgtttcggcgacaacattcaggccctgcgtgtg
gccggctcgttcgacgactgccaggcgatggtcaaacaggccttgaacgatgccgcgttg
cagacgcaggtgccgctgagttcggccaacagcatcagcctgggccggctgctgccgcag
atgagttactacgcgcatgccgcgctgcagcaccatgcggcgtggggcgacgtgctcaac
ctggtggtgcccaccggcaacctgggcaacgcgctggcggcgatcatcgcgcgcgcgctc
ggggtgccattaggccgcatcgcgctggcctccaacgccaaccatgtcttgccggactat
ttcgctggcgacgcgtacgcgccgcagcccagcgtggccacgctggccaatgcgatggac
gtgggcgcgccgagcaatttcgagcggctgcgttggctctacaacggcgacgatgccgcc
ttgcgcgaggaattccgtgcgttgtcggtggacgacgcagcgattcgccacaccgtgcag
cagcgtttcgcgcgctatggcgaggtgcattgcccgcataccgccaccgcggtgcatgtg
cttgaacaactgcgtgccgagggcgcggagggcggcaccggcgattgggcggtggcggcc
acggcgcatccggccaagttcgaaggcgtggtggagccattgatcggccggacggtggag
gttccgccggcgctggccgcgctgctgcagcgcccagcgcaagccgaagcactggcggcg
gactatgcggctttccggcagcgtctgcttgcggatgcgacctga

DBGET integrated database retrieval system