KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2192Help
Entry
XOO_2192          CDS       T00360                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO_2192 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO_2192 (glk)
   00052 Galactose metabolism
    XOO_2192 (glk)
   00500 Starch and sucrose metabolism
    XOO_2192 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XOO_2192 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOO_2192 (glk)
   00524 Butirosin and neomycin biosynthesis
    XOO_2192 (glk)
Enzymes [BR:xom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XOO_2192 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2431128..2432135
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADVDASVPLLDDTSREFAVVDFTSLGEAARYYLDQIGV
QATQGVFAVAGRVDGDEARITNHPWVISRSRTASMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIDQPRNYGVIGPGTGLGVGGLIIRHGRCFPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRALSEIAGVDPGPLQPKDITARAAAGDPRS
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSRVPSLAVMHPHAGLLGAAAYAVDAQRQPPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccaagccggtgctggttgccgatatcggcggaaccaatgcgcgtttc
gcgctggccgatgtcgacgcctcggtgccgttactggatgacacctcgcgcgaatttgcc
gtggtggacttcacctcgctcggcgaagccgcgcgctattatctcgaccagatcggcgtg
caggccacccagggcgtgttcgcggtggccggccgcgtggatggcgacgaagcacgtatc
accaatcacccgtgggtgatctcgcgttcgcgcactgccagcatgctgggtttcagtacc
ttgcacctgatcaacgacttcgccgcgcaggcgatggcgatcagcctgctgcgtccgcag
gacgtggtgcaggtgggcggcgccagttggcgcccggcgccgatcgatcagccgcgcaac
tacggcgtgatcggccccggcaccggcctgggcgtgggtggcctgatcatccgccacggg
cgctgctttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gaaatccgcatcctggaaatcctctccgagcagttcggccgggtttccaacgagcgcctg
atctgcggcccgggcctggtcaacatccaccgcgcgctgagtgagattgccggagtcgat
ccgggcccgctgcaacccaaggacatcaccgcacgcgccgcggcgggcgacccgcgttcg
tcgcgcacgatcgatttgttctgcgccatcttcggagcgatcgctggcgacatggtgctc
atgcagggtgcctgggacggcgtgttccttaccggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggctttcgccagcgcttcgaacacaagggccgtttctccgcgatc
atgtcgcgggtgccgtcgctggcggtcatgcacccgcatgccggcctgctcggcgccgcc
gcgtatgcggtggatgcacaacgtcagccccccggggaacagcgatga

DBGET integrated database retrieval system