KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2219Help
Entry
XOO_2219          CDS       T00360                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XOO_2219
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XOO_2219
Enzymes [BR:xom01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XOO_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2458546..2459031)
Genome map
AA seq 161 aa AA seqDB search
MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctctccacctttgaattcaccgaccttgagggtcgcacgcagacgatgcgc
gactacgccggcaaggtgctgctggtggtgaatgtggcatccaaatgcggctttacgccg
cagtacgccggcttgcaggccttatggcaacgctaccgcgagcgcgggctggtagtcatc
ggatttccgtgcgatcagtttgggcatcaagagccaggtgatgcggcgcagatccgccaa
ttttgctcgctcgactacgcagtggattttccgctggccgaaaaaatcgaggtcaacggc
agcggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcggctcc
gaggcgatcaagtggaatttcaccaaattcctgatcggccgcgacggccgcgtgctggaa
cgttatgcgcccacgaccaagccggaagcattggccgcagatatcgagcgtgcattggac
gcatga

DBGET integrated database retrieval system