KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2512Help
Entry
XOO_2512          CDS       T00360                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO_2512
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XOO_2512
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XOO_2512
Enzymes [BR:xom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XOO_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2805795..2806949)
Genome map
AA seq 384 aa AA seqDB search
MSTPASTSSPFAEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREL
VIVSSGAVAAGRAILPKAVDVGAPIAARQALAALGQAQLIALWQRFFERAVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDDVPELTPEVLAMAGGSGSNVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSGEVVRALAQDRLRGTRIHAARTRIAARKYWLRHAPVEAGAILVDAGAAM
ALSDKGASLLPGGVVGAEGDFRRGDMVEIRLRDDEGERCLARGVSQYSAVDIRRIARRHS
RDIENVLGYSYGENVVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccagccagcacgtcgtcgccctttgccgagcaggcactgccgccgtggcgg
cgtgccgtgctcaaggtcggcagtagcctgcttgctgccgatggcggtggcctgtcgccg
cgtttcgcattggggctggcgcagttcgtctctgctaacctggcggcggggcgcgagctg
gtgatcgtgtcgtcgggcgcagtggcggcgggccgcgccatcctgccgaaagcggtggat
gtcggcgcgccgatcgcggcacgtcaagcgctggctgcgctcggccaggcgcagttgatc
gcgctgtggcagcgctttttcgagcgcgcggtggcgcaggtgctgctcacccatgacgat
ctgcgcaaccgtcgccgctatctcaatgcacgcgccacattgggcgagttgttgcggttg
ggcgcgttgccggtgatcaacgaaaacgacaccgtttcggtggatgagttgaagctgggc
gataacgacaacctggccgcaatcgtggccgccttggtcgatgccgatgccttgttcatc
gccactgatatcgacggcttgtatagcgccgacccacgcagtaaccccttggcgcggccg
ctcgacgatgtgcccgagctcacgccggaggtgctggcgatggctggcggcagcggcagc
aatgtaggcaccggcggcatgcgcaccaaattggaagccgctgcaaaggcgggtgcggcc
ggcatcgaaacctatctgttcaacggccgcagtggcgaggtggtgcgcgccctggcgcag
gaccgcctgcgtggcacgcgcatccatgccgcacgcacgcgcattgccgcacgcaagtac
tggctacggcacgcgccggtggaagcgggcgcgattctggtcgatgccggcgcagcaatg
gcgctgagcgacaagggcgcctcgctgttgccgggcggtgtggtcggtgccgagggcgat
ttccgccgcggcgacatggtggagattcgcctgcgtgatgacgagggcgaacgttgtctg
gcacgcggcgtcagccagtattcggcagtggatatccgtcgcatcgcacgccgccactcg
cgcgacatcgagaacgtactcggttacagctatggcgagaacgtggtgcatcgcgatgat
ttggtgttgttgtag

DBGET integrated database retrieval system